TCAL8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCAL8_HUMAN
• UniProt AC: Q8IYN2
• Protein Name: Transcription elongation factor A protein-like 8
• Gene Name: TCEAL8
• Organism: Homo sapiens (Human).
• Sequence Length: 117
• Subcellular Localization: Nucleus .
• Protein Description: May be involved in transcriptional regulation..
• Protein Sequence: MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Methylation	QEAEGNPRGGPNQPG HHCCCCCCCCCCCCC	67.70	115918309
62	Ubiquitination	NQPGQGFKEDTPVRH CCCCCCCCCCCCCCC	62.60	27667366
106	Phosphorylation	MHWKQRHSRSRPYPV HHHHHHHCCCCCCCE	33.85	17081983
108	Phosphorylation	WKQRHSRSRPYPVCF HHHHHCCCCCCCEEC	40.39	17081983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCAL8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCAL8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCAL8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.