TBX2_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TBX2_CAEEL
• UniProt AC: Q19691
• Protein Name: T-box protein 2
• Gene Name: tbx-2
• Organism: Caenorhabditis elegans.
• Sequence Length: 423
• Subcellular Localization: Nucleus .
• Protein Description: Involved in the development of pharyngeal muscles derived from the ABa lineage..
• Protein Sequence: MAFNPFALGRPDLLLPFMGAGVGGPGAGGPPPNLFFSMLQAGFPPGPVGSPPEDDGVTDDPKVELDERELWQQFSQCGTEMVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPADEHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGANFHKLKLTNNISDKHGYTILNSMHKYQPRLHVVRCADRHNLMYSTFRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKGFRDAGAGKREKKRQLHRMNGDATQSPPGKTASLPTHSPHPSESNSEDDEPTLKKCKPEPSQTPTTSSLSTSTTPTLSAHHPLRSPQFCIPPPIDMMYQNMPMDLLAHWQMATLFPQFSMALNSPAAAASLLSKHLAKASSECKVEATSEDSEEAEKPEVKKEQKSVTPPKKGGFDVLDLLSKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
265	Phosphorylation	MNGDATQSPPGKTAS CCCCCCCCCCCCCCC	28.80	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TBX2_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TBX2_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TBX2_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC9_CAEEL	ubc-9	physical	23595631

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.