TBB1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TBB1_ARATH
• UniProt AC: P12411
• Protein Name: Tubulin beta-1 chain
• Gene Name: TUBB1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 447
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain..
• Protein Sequence: MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSADLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCSLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQILNVQNKNSSYFVEWIPNNVKSSVCDIPPTGIKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEDEYDEEEEQVYES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
139	Phosphorylation	QGFQVCHSLGGGTGS CCEEEEHHCCCCCCC	24.47	25368622
144	Phosphorylation	CHSLGGGTGSGMGTL EHHCCCCCCCCHHHH	31.30	25368622
146	Phosphorylation	SLGGGTGSGMGTLLI HCCCCCCCCHHHHHH	25.99	25368622
366	Phosphorylation	PTGIKMASTFVGNST CCCCEECHHHCCCCH	20.91	25368622
367	Phosphorylation	TGIKMASTFVGNSTS CCCEECHHHCCCCHH	16.89	25368622
372	Phosphorylation	ASTFVGNSTSIQEMF CHHHCCCCHHHHHHH	20.01	25368622
373	Phosphorylation	STFVGNSTSIQEMFR HHHCCCCHHHHHHHH	33.57	25368622
374	Phosphorylation	TFVGNSTSIQEMFRR HHCCCCHHHHHHHHH	23.30	25368622

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TBB1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TBB1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TBB1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
14335_ARATH	GRF5	physical	21558460

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.