TAF9_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TAF9_ARATH
• UniProt AC: Q9SYH2
• Protein Name: Transcription initiation factor TFIID subunit 9
• Gene Name: TAF9
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 183
• Subcellular Localization: Nucleus .
• Protein Description: TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription..
• Protein Sequence: MAGEGEEDVPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVEVLTDAQVYSEHASKPNIDCDDVKLAIQSKVNFSFSQPPPREVLLELAASRNKIPLPKSIAGPGVPLPPEQDTLLSPNYQLVIPKKSVSTEPEETEDDEEMTDPGQSSQEQQQQQQQTSDLPSQTPQRVSFPLSRRPK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGEGEEDV ------CCCCCCCCC		22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TAF9_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TAF9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TAF9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF6_ARATH	TAFII59	physical	17340043
TAF12_ARATH	TAF12	physical	17340043
TAF10_ARATH	TAFII15	physical	17340043
TAF5_ARATH	TAF5	physical	17340043
TAF4B_ARATH	TAF4	physical	17340043

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.