dbPTM

SYT1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SYT1_ARATH
UniProt AC	Q9SKR2
Protein Name	Synaptotagmin-1
Gene Name	SYT1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	541
Subcellular Localization	Cell membrane Single-pass membrane protein Cytoplasmic side. Endosome membrane Single-pass membrane protein.
Protein Description	Plays an important role in maintaining plasma membrane integrity during freezing and osmotic stresses. May function in membrane resealing during calcium-dependent freezing tolerance. May regulate endocytosis and endosome recycling at the plasma membrane and cell-to-cell trafficking of cabbage leaf curl virus (CaLCuV) and tobacco mosaic virus (TMV) movement proteins via plasmodesmata..
Protein Sequence	MGFFSTILGFCGFGVGISLGLVIGYVLFVYLLPNDVKDPEIRSIADQDPKAMLRMLPEIPLWVKNPDFDRVDWINRFLEYMWPYLDKAICKTAKNIAKPIIEEQIPKYKIDSVEFETLTLGSLPPTFQGMKVYLTDEKELIMEPCLKWAANPNILVAIKAFGLKATVQVVDLQVFAQPRITLKPLVPSFPCFANIYVSLMEKPHVDFGLKLGGADLMSIPGLYRFVQEQIKDQVANMYLWPKTLVVPILDPAKAFRRPVGIVHVKVVRAVGLRKKDLMGGADPFVKIKLSEDKIPSKKTTVKHKNLNPEWNEEFKFSVRDPQTQVLEFSVYDWEQVGNPEKMGMNVLALKEMVPDEHKAFTLELRKTLDGGEDGQPPDKYRGKLEVELLYKPFTEEEMPKGFEETQAVQKAPEGTPAAGGMLVVIVHSAEDVEGKHHTNPYVRIYFKGEERKTKHVKKNRDPRWNEEFTFMLEEPPVREKLHVEVLSTSSRIGLLHPKETLGYVDIPVVDVVNNKRMNQKFHLIDSKNGKIQIELEWRTAS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
84	Phosphorylation	FLEYMWPYLDKAICK HHHHHHHHHHHHHHH		23820729

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SYT1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SYT1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SYT1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SUMO3_ARATH	SUMO3	physical	20855607

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SYT1_ARATH

Related Literatures of Post-Translational Modification