dbPTM

SYCP3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SYCP3_MOUSE
UniProt AC	P70281
Protein Name	Synaptonemal complex protein 3
Gene Name	Sycp3
Organism	Mus musculus (Mouse).
Sequence Length	254
Subcellular Localization	Nucleus . Chromosome . Chromosome, centromere . It is present in early unpaired cores, in the lateral domains of the synaptonemal complex and in the chromosome cores when they separate at diplotene. It is found axial to the metaphase I chromosomes an
Protein Description	Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. [PubMed: 11311943]
Protein Sequence	MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEEDVADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKASNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQQSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQEMANVRKSLQSMLF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MLRGCGDSDSSPEPL CCCCCCCCCCCCCHH	25.36	22817900
10	Phosphorylation	RGCGDSDSSPEPLSK CCCCCCCCCCCHHHH	52.31	22817900
11	Phosphorylation	GCGDSDSSPEPLSKH CCCCCCCCCCHHHHH	37.97	22817900
55	Phosphorylation	EKDDKDLSGSEEDVA CCCCCCCCCCHHHHH	50.86	21149613
57	Phosphorylation	DDKDLSGSEEDVADE CCCCCCCCHHHHHHC	34.14	21149613
77	Phosphorylation	DKHGKKRSAGIIEDV CCCCCCCCCCCCCCC	39.46	22817900
218	Phosphorylation	NDNLFTGTQSELKKE CCCCCCCCHHHHHHH	26.34	22817900
251	Phosphorylation	NVRKSLQSMLF---- HHHHHHHHHHC----	23.81	22871156

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SYCP3_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SYCP3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SYCP3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SYCP2_MOUSE	Sycp2	physical	16717126

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SYCP3_MOUSE

Related Literatures of Post-Translational Modification