UniProt ID | SWI5_HUMAN | |
---|---|---|
UniProt AC | Q1ZZU3 | |
Protein Name | DNA repair protein SWI5 homolog | |
Gene Name | SWI5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 235 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination.. | |
Protein Sequence | MQRRGQRDLWRHNKSCARNRCPRPPRERGGAGFPWVRAQLSVRQFTLRVRVPGPVHLRGRSPTPALDPLAPLNPLIRGPRTPGLRRWIQSLALLLPNCSSSRIPTVPRPHSGLWVQSDFPLGFLSRTEPRLTRSCRGAFRSPRPLPKSGQADGTSEESLHLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGLDMND | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | QLSVRQFTLRVRVPG EEEEEEEEEEEECCC | 12.81 | 24719451 | |
61 | Phosphorylation | PVHLRGRSPTPALDP CEEECCCCCCCCCCC | 35.63 | 24719451 | |
63 | Phosphorylation | HLRGRSPTPALDPLA EECCCCCCCCCCCCC | 23.57 | 24719451 | |
134 | Phosphorylation | TEPRLTRSCRGAFRS CCCCCCHHCCCCCCC | 11.70 | - | |
141 | Phosphorylation | SCRGAFRSPRPLPKS HCCCCCCCCCCCCCC | 20.86 | 29214152 | |
148 | Phosphorylation | SPRPLPKSGQADGTS CCCCCCCCCCCCCCC | 33.91 | 25159151 | |
223 | Trimethylation | VIRGVTTKELYPEFG HHCCCCHHHHCHHHC | 36.03 | - | |
223 | Methylation | VIRGVTTKELYPEFG HHCCCCHHHHCHHHC | 36.03 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWI5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWI5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWI5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SFR1_HUMAN | SFR1 | physical | 21252223 | |
RAD51_HUMAN | RAD51 | physical | 21252223 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...