SUVR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SUVR1_ARATH
• UniProt AC: Q946J2
• Protein Name: Probable inactive histone-lysine N-methyltransferase SUVR1
• Gene Name: SUVR1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 734
• Subcellular Localization: Nucleus . Chromosome .
• Protein Description: Probable inactive histone-lysine methyltransferase that acts as regulator of transctiptional gene silencing independently of histone H3K9 methylation. Contributes to transcriptional gene silencing at RNA-directed DNA methylation (RdDM) target loci but also at RdDM-independent target loci..
• Protein Sequence: MAPNLRIKKACDAMKLLGISETKTRAFLRKLLKTYENNWDFIEEDAYKVLLDAIFDEADAQSTEKNKKEEEKKKKEEEKKSRSVATSRGRRKAPEPLVQDEEDDMDEDEFPLKRRLRSRRGRASSSSSSSSSYNNEDLKTQPEEEDEDDGVTELPPLKRYVRRNGERGLAMTVYNNASPSSSSRLSMEPEEVPPMVLLPAHPMETKVSEASALVILNDEPNIDHKPVISDTGNCSAPMLEMGKSNIHVQEWDWETKDILNDTTAMDVSPSSAIGESSEHKVAAASVELASSTSGEAKICLSFAPATGETTNLHLPSMEDLRRAMEEKCLKSYKIVHPEFSVLGFMKDMCSCYIDLAKNSTSQLLETETVCDMSKAGDESGAVGISMPLVVVPECEISGDGWKAISNMKDITAGEENVEIPWVNEINEKVPSRFRYMPHSFVFQDAPVIFSLSSFSDEQSCSTSCIEDCLASEMSCNCAIGVDNGFAYTLDGLLKEEFLEARISEARDQRKQVLRFCEECPLERAKKVEILEPCKGHLKRGAIKECWFKCGCTKRCGNRVVQRGMHNKLQVFFTPNGKGWGLRTLEKLPKGAFICEYIGEILTIPELYQRSFEDKPTLPVILDAHWGSEERLEGDKALCLDGMFYGNISRFLNHRCLDANLIEIPVQVETPDQHYYHLAFFTTRDIEAMEELAWDYGIDFNDNDSLMKPFDCLCGSRFCRNKKRSTKTMQILNKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	FDEADAQSTEKNKKE HHHHHHHHHHHHHHH	40.01	23776212
63	Phosphorylation	DEADAQSTEKNKKEE HHHHHHHHHHHHHHH	38.61	23776212
178	Phosphorylation	MTVYNNASPSSSSRL EEEEECCCCCCCCCC	27.69	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SUVR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SUVR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SUVR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUVR2_ARATH	SUVR2	physical	25420628
SUVR1_ARATH	SUVR1	physical	25420628

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.