dbPTM

SUOX_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SUOX_ARATH
UniProt AC	Q9S850
Protein Name	Sulfite oxidase
Gene Name	SOX
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	393
Subcellular Localization	Peroxisome .
Protein Description	Probably involved in sulfite oxidative detoxification..
Protein Sequence	MPGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRLGHSNL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SUOX_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SUOX_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SUOX_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SUOX_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PEX5_ARATH	PEX5	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SUOX_ARATH

Related Literatures of Post-Translational Modification