dbPTM

SUMF2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SUMF2_MOUSE
UniProt AC	Q8BPG6
Protein Name	Inactive C-alpha-formylglycine-generating enzyme 2 {ECO:0000305}
Gene Name	Sumf2 {ECO:0000312\|MGI:MGI:1915152}
Organism	Mus musculus (Mouse).
Sequence Length	308
Subcellular Localization	Endoplasmic reticulum lumen .
Protein Description	Lacks formylglycine generating activity and is unable to convert newly synthesized inactive sulfatases to their active form. Inhibits the activation of sulfatases by SUMF1..
Protein Sequence	MRSEFWFPSMGSLLPPVLLLWLLSCPRLQLGHAQDPAMVHLPGGRFLMGTDAPDGRDGEGPAREVTVKPFAIDIFPVTNKDFREFVREKKYQTEAEAFGWSFVFEDFVSPELRKQENLMPAVHWWQPVPKAFWRQPAGPGSGIREKLELPVVHVSWNDAGAYCAWRGRRLPTEEEWEFAARGGLKGQVYPWGNRFQPNRTNLWQGKFPKGDKAEDGFHGLSPVNAFPPQNNYGLYDLMGNVWEWTASTYQPAGQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCASSAGRPKEDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
198	N-linked_Glycosylation	WGNRFQPNRTNLWQG CCCCCCCCCCCCCCC	53.26	-
299	Phosphorylation	NLGFRCASSAGRPKE CCCCCCHHCCCCCCC	25.09	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SUMF2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SUMF2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SUMF2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SUMF1_MOUSE	Sumf1	physical	15962010
SUMF2_MOUSE	Sumf2	physical	15962010

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SUMF2_MOUSE

Related Literatures of Post-Translational Modification