UniProt ID | STEP1_ARATH | |
---|---|---|
UniProt AC | Q9M7I9 | |
Protein Name | Stress enhanced protein 1, chloroplastic {ECO:0000305} | |
Gene Name | SEP1 {ECO:0000303|PubMed:10725357} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 146 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in non-photochemical quenching, a process that maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage (By similarity). May play a photoprotective role in the thylakoid membrane in response to light stress (Probable).. | |
Protein Sequence | MALSQVSASLAFSLPNSGALKLATITNPTSTCRVHVPQLAGIRSTFASGSPLLPLKLSMTRRGGNRAASVSIRSEQSTEGSSGLDIWLGRGAMVGFAVAITVEISTGKGLLENFGVASPLPTVALAVTALVGVLAAVFIFQSSSKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STEP1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STEP1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STEP1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AG_ARATH | AG | physical | 17693535 | |
AGL1_ARATH | SHP1 | physical | 17693535 | |
AGL5_ARATH | SHP2 | physical | 17693535 | |
AGL11_ARATH | STK | physical | 17693535 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...