UniProt ID | STEAL_HUMAN | |
---|---|---|
UniProt AC | Q6NZ63 | |
Protein Name | STEAP family member 1B | |
Gene Name | STEAP1B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 245 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Ubiquitination | HADEFDCPSELQHAQ CCCCCCCCHHHHHHH | 32.46 | 29901268 | |
141 | Phosphorylation | WLDKWMLTRKQFGLL HHHHHHHHHHHHHHH | 21.51 | - | |
159 | Phosphorylation | FAVLHAIYTLSYAMR HHHHHHHHHHHHHHH | 11.47 | - | |
200 | Phosphorylation | DVWRMEIYVSLGIVG CHHHHHHHHHHHHHH | 3.18 | - | |
202 | Phosphorylation | WRMEIYVSLGIVGLA HHHHHHHHHHHHHHH | 12.14 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STEAL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STEAL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STEAL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STEA1_HUMAN | STEAP1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...