UniProt ID | STEA1_HUMAN | |
---|---|---|
UniProt AC | Q9UHE8 | |
Protein Name | Metalloreductase STEAP1 | |
Gene Name | STEAP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 339 | |
Subcellular Localization |
Endosome membrane Multi-pass membrane protein. |
|
Protein Description | Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity).. | |
Protein Sequence | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | RNLEEDDYLHKDTGE CCCCCCCCCCCCCCC | 24.03 | 21945579 | |
30 | Ubiquitination | EEDDYLHKDTGETSM CCCCCCCCCCCCCCC | 55.16 | 33845483 | |
39 | Ubiquitination | TGETSMLKRPVLLHL CCCCCCCCCCHHHHH | 46.12 | 29901268 | |
83 | Phosphorylation | KIAAIIASLTFLYTL HHHHHHHHHHHHHHH | 19.96 | 22210691 | |
160 | Phosphorylation | WLDKWMLTRKQFGLL HHHHHHHHHHHHHHH | 21.51 | - | |
177 | Ubiquitination | FFAVLHAIYSLSYPM HHHHHHHHHHCCCCC | 1.35 | 21906983 | |
178 | Phosphorylation | FAVLHAIYSLSYPMR HHHHHHHHHCCCCCH | 12.35 | - | |
188 | Phosphorylation | SYPMRRSYRYKLLNW CCCCHHHHHHHHHHH | 19.02 | - | |
219 | Phosphorylation | DVWRMEIYVSLGIVG CHHHHHHHHHHHHHH | 3.18 | - | |
221 | Phosphorylation | WRMEIYVSLGIVGLA HHHHHHHHHHHHHHH | 12.14 | - | |
329 | Ubiquitination | HGWEDVTKINKTEIC CCCCCCHHCCHHHHH | 44.10 | 33845483 | |
332 | Ubiquitination | EDVTKINKTEICSQL CCCHHCCHHHHHCCC | 51.51 | 33845483 | |
337 | Phosphorylation | INKTEICSQL----- CCHHHHHCCC----- | 39.93 | 22617229 | |
476 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------ | 21906983 | ||
479 | Ubiquitination | --------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------- | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STEA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STEA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STEA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GOLP3_HUMAN | GOLPH3 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...