UniProt ID | STA10_HUMAN | |
---|---|---|
UniProt AC | Q9Y365 | |
Protein Name | START domain-containing protein 10 | |
Gene Name | STARD10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 291 | |
Subcellular Localization | Cell projection, cilium, flagellum. Cytoplasm . Membrane . In testis was predominantly detected at the flagella of elongated spermatids, with a strong signal also found at the tail of epididymal sperm (By similarity). Mainly cytosolic.. | |
Protein Description | May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.. | |
Protein Sequence | MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEKLAAST -------CCCHHCCC | 22814378 | ||
7 | Phosphorylation | -MEKLAASTEPQGPR -CCCHHCCCCCCCCC | 25849741 | ||
8 | Phosphorylation | MEKLAASTEPQGPRP CCCHHCCCCCCCCCC | 26270265 | ||
21 | Phosphorylation | RPVLGRESVQVPDDQ CCCCCCCCCCCCCCC | 24719451 | ||
94 | Succinylation | HDIEYRKKWDSNVIE HHHHHHHCCCCCCEE | - | ||
94 | Succinylation | HDIEYRKKWDSNVIE HHHHHHHCCCCCCEE | - | ||
97 | Phosphorylation | EYRKKWDSNVIETFD HHHHCCCCCCEEEEE | 27174698 | ||
102 | Phosphorylation | WDSNVIETFDIARLT CCCCCEEEEEEEEEE | 27174698 | ||
109 | Phosphorylation | TFDIARLTVNADVGY EEEEEEEEECCCCEE | 27174698 | ||
143 | Phosphorylation | WLPMGADYIIMNYSV CCCCCCCEEEEECCC | - | ||
148 | Phosphorylation | ADYIIMNYSVKHPKY CCEEEEECCCCCCCC | - | ||
155 | Phosphorylation | YSVKHPKYPPRKDLV CCCCCCCCCCHHHHH | - | ||
166 | Phosphorylation | KDLVRAVSIQTGYLI HHHHEEEEHHHCEEE | 24719451 | ||
194 | Phosphorylation | AQVDPKGSLPKWVVN EECCCCCCCCHHHCC | 28348404 | ||
197 | Succinylation | DPKGSLPKWVVNKSS CCCCCCCHHHCCCCC | - | ||
197 | Succinylation | DPKGSLPKWVVNKSS CCCCCCCHHHCCCCC | - | ||
202 | Succinylation | LPKWVVNKSSQFLAP CCHHHCCCCCCCCCH | - | ||
202 | Succinylation | LPKWVVNKSSQFLAP CCHHHCCCCCCCCCH | - | ||
203 | Phosphorylation | PKWVVNKSSQFLAPK CHHHCCCCCCCCCHH | 30622161 | ||
204 | Phosphorylation | KWVVNKSSQFLAPKA HHHCCCCCCCCCHHH | 30622161 | ||
242 | Phosphorylation | PWLHPEQSPLPSLAL CCCCCCCCCCCHHHH | 26330541 | ||
246 | Phosphorylation | PEQSPLPSLALSELS CCCCCCCHHHHHHHH | 26330541 | ||
250 | Phosphorylation | PLPSLALSELSVQHA CCCHHHHHHHHHHCH | 26657352 | ||
253 | Phosphorylation | SLALSELSVQHADSL HHHHHHHHHHCHHHH | 29759185 | ||
259 | Phosphorylation | LSVQHADSLENIDES HHHHCHHHHCCCCHH | 15704244 | ||
266 | Phosphorylation | SLENIDESAVAESRE HHCCCCHHHHHHHHH | 28102081 | ||
284 | Phosphorylation | GGAGGEGSDDDTSLT CCCCCCCCCCCCCCC | 25159151 | ||
288 | Phosphorylation | GEGSDDDTSLT---- CCCCCCCCCCC---- | 30278072 | ||
289 | Phosphorylation | EGSDDDTSLT----- CCCCCCCCCC----- | 30278072 | ||
291 | Phosphorylation | SDDDTSLT------- CCCCCCCC------- | 28176443 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
284 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
284 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
284 | S | Phosphorylation |
| 17561512 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STA10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
ANM6_HUMAN | PRMT6 | physical | 23455924 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...