UniProt ID | SSXT_MOUSE | |
---|---|---|
UniProt AC | Q62280 | |
Protein Name | Protein SSXT | |
Gene Name | Ss18 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 418 | |
Subcellular Localization | Nucleus. | |
Protein Description | Appears to function synergistically with RBM14 as transcription coactivator.. | |
Protein Sequence | MSVAFAAPRQRGKGEITPAAIQKMLDENNHLIQCIMDYQNKGKASECSQYQQILHTNLVYLATIADSNQNMQSLLPAPPTQTMPMGPGGMSQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPSQLSMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMNMQPNQGPMMHQQPPSQQYNMPPGGAQHYQGQQAPMGLMGQVNQGSHMMGQRQMPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQSYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSVAFAAPR ------CCCCCCCCC | 23.35 | - | |
2 | Phosphorylation | ------MSVAFAAPR ------CCCCCCCCC | 23.35 | 29176673 | |
13 | Ubiquitination | AAPRQRGKGEITPAA CCCCCCCCCCCCHHH | 56.40 | - | |
13 | Acetylation | AAPRQRGKGEITPAA CCCCCCCCCCCCHHH | 56.40 | 23806337 | |
148 | Phosphorylation | SQLSMTNSSMNMPSS HHCCCCCCCCCCCCC | 23.07 | - | |
149 | Phosphorylation | QLSMTNSSMNMPSSS HCCCCCCCCCCCCCC | 19.08 | - | |
264 | Phosphorylation | QQGPPQQYSGQEDYY CCCCCCCCCCCCCCC | 14.99 | - | |
265 | Phosphorylation | QGPPQQYSGQEDYYG CCCCCCCCCCCCCCC | 29.66 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSXT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSXT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSXT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATF2_MOUSE | Atf2 | physical | 22439931 | |
TLE1_MOUSE | Tle1 | physical | 22439931 | |
HDAC1_MOUSE | Hdac1 | physical | 22439931 | |
EZH2_MOUSE | Ezh2 | physical | 22439931 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...