SSR2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SSR2_RAT
• UniProt AC: P30680
• Protein Name: Somatostatin receptor type 2
• Gene Name: Sstr2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 369
• Subcellular Localization: Cell membrane; Multi-pass membrane protein. Cytoplasm. Located mainly at the cell surface under basal conditions. Agonist stimulation results in internalization to the cytoplasm.
• Protein Description: Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization..
• Protein Sequence: MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	N-linked_Glycosylation	ELTSEQFNGSQVWIP CCCCCCCCCCEEEEC	49.23	-
22	N-linked_Glycosylation	IPSPFDLNGSLGPSN ECCCCCCCCCCCCCC	39.59	-
29	N-linked_Glycosylation	NGSLGPSNGSNQTEP CCCCCCCCCCCCCCC	62.13	-
32	N-linked_Glycosylation	LGPSNGSNQTEPYYD CCCCCCCCCCCCCCC	54.94	-
328	S-palmitoylation	KSFQNVLCLVKVSGA HHHCCEEEEEEECCC	3.41	-
341	Phosphorylation	GAEDGERSDSKQDKS CCCCCCCCCCHHHHH	41.77	21330405
343	Phosphorylation	EDGERSDSKQDKSRL CCCCCCCCHHHHHHH	33.20	21330405
348	Phosphorylation	SDSKQDKSRLNETTE CCCHHHHHHHCCCHH	50.74	19389921
353	Phosphorylation	DKSRLNETTETQRTL HHHHHCCCHHHHHHH	28.94	21330405
354	Phosphorylation	KSRLNETTETQRTLL HHHHCCCHHHHHHHH	30.75	21330405
356	Phosphorylation	RLNETTETQRTLLNG HHCCCHHHHHHHHCC	22.66	21330405
359	Phosphorylation	ETTETQRTLLNGDLQ CCHHHHHHHHCCCCC	26.27	21330405
367	Phosphorylation	LLNGDLQTSI----- HHCCCCCCCC-----	35.37	22673903
368	Phosphorylation	LNGDLQTSI------ HCCCCCCCC------	17.22	22673903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
341	S	Phosphorylation	Kinase	GRK2	P25098	PSP
343	S	Phosphorylation	Kinase	GRK2	P25098	PSP
343	S	Phosphorylation	Kinase	PRKCA	P17252	GPS
353	T	Phosphorylation	Kinase	GRK2	P25098	PSP
353	T	Phosphorylation	Kinase	GRK3	P35626	PSP
354	T	Phosphorylation	Kinase	GRK2	P25098	PSP
354	T	Phosphorylation	Kinase	GRK3	P35626	PSP
356	T	Phosphorylation	Kinase	GRK2	P25098	PSP
356	T	Phosphorylation	Kinase	GRK3	P35626	PSP
359	T	Phosphorylation	Kinase	GRK2	P25098	PSP
359	T	Phosphorylation	Kinase	GRK3	P35626	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SSR2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SSR2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DLG3_HUMAN	DLG3	physical	10373412
SNTA1_HUMAN	SNTA1	physical	10373412
SHAN2_HUMAN	SHANK2	physical	10373412
SHAN2_RAT	Shank2	physical	10373412

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.