| UniProt ID | SRP19_HUMAN | |
|---|---|---|
| UniProt AC | P09132 | |
| Protein Name | Signal recognition particle 19 kDa protein | |
| Gene Name | SRP19 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 144 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.. | |
| Protein Sequence | MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MACAAARSP ------CCCCCCCCH | 7.52 | - | |
| 8 | Phosphorylation | MACAAARSPADQDRF CCCCCCCCHHHCCCE | 21.51 | 25159151 | |
| 8 (in isoform 3) | Phosphorylation | - | 21.51 | - | |
| 14 | Methylation | RSPADQDRFICIYPA CCHHHCCCEEEEEEH | 19.73 | 115917781 | |
| 26 | 2-Hydroxyisobutyrylation | YPAYLNNKKTIAEGR EEHHHCCCCCHHCCC | 50.66 | - | |
| 38 | Phosphorylation | EGRRIPISKAVENPT CCCCCCCHHHCCCCC | 14.81 | - | |
| 68 (in isoform 3) | Phosphorylation | - | 13.24 | - | |
| 102 | Ubiquitination | LVQFPSRKSVMLYAA EEECCCCHHHHHHHH | 52.30 | - | |
| 103 | Phosphorylation | VQFPSRKSVMLYAAE EECCCCHHHHHHHHH | 16.20 | 29759185 | |
| 121 | Ubiquitination | KLKTRTQKTGGADQS HHCCCCCCCCCCCHH | 48.82 | - | |
| 122 | Phosphorylation | LKTRTQKTGGADQSL HCCCCCCCCCCCHHH | 30.91 | 26074081 | |
| 128 | Phosphorylation | KTGGADQSLQQGEGS CCCCCCHHHHCCCCC | 28.79 | 25002506 | |
| 135 | Phosphorylation | SLQQGEGSKKGKGKK HHHCCCCCCCCCCCC | 27.22 | 23401153 | |
| 136 | Acetylation | LQQGEGSKKGKGKKK HHCCCCCCCCCCCCC | 76.13 | 26051181 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRP19_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRP19_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRP19_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TNPO1_HUMAN | TNPO1 | physical | 11682607 | |
| IPO5_HUMAN | IPO5 | physical | 11682607 | |
| IPO7_HUMAN | IPO7 | physical | 11682607 | |
| IPO8_HUMAN | IPO8 | physical | 11682607 | |
| ZC11A_HUMAN | ZC3H11A | physical | 22939629 | |
| ZFAN5_HUMAN | ZFAND5 | physical | 22939629 | |
| STAM2_HUMAN | STAM2 | physical | 22863883 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
