SRA1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SRA1_MOUSE
• UniProt AC: Q80VJ2
• Protein Name: Steroid receptor RNA activator 1
• Gene Name: Sra1 {ECO:0000312|MGI:MGI:1344414}
• Organism: Mus musculus (Mouse).
• Sequence Length: 232
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis (By similarity)..
• Protein Sequence: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLTKRVAAPQDGSPRAPETSGPPPVDHPPPSSKASRPPPMGSCPATGVEPPSSPVIESETLIEDVLRPLEQALEDCHGHTKKQVCDDISRRLALLREQWAGGKLSIPVKKRMALLVQELLHHQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKKSLSSEETKEEKFTVEPENQTIPGFQQPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Phosphorylation	NDPPQFSYGLQTQTG CCCCCCCCCEECCCC	24.12	29514104
60	Phosphorylation	VAAPQDGSPRAPETS CCCCCCCCCCCCCCC	21.36	27087446
66	Phosphorylation	GSPRAPETSGPPPVD CCCCCCCCCCCCCCC	37.61	26160508
67	Phosphorylation	SPRAPETSGPPPVDH CCCCCCCCCCCCCCC	47.87	26160508
78	Phosphorylation	PVDHPPPSSKASRPP CCCCCCCCCCCCCCC	50.69	25777480
79	Phosphorylation	VDHPPPSSKASRPPP CCCCCCCCCCCCCCC	37.71	25777480
205	Phosphorylation	RLIAEKKSLSSEETK HHHHHHHCCCCHHHH	44.55	26824392
232	Phosphorylation	IPGFQQPS------- CCCCCCCC-------	48.82	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SRA1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SRA1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SRA1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRAF6_MOUSE	Traf6	physical	21460221

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.