SPT4_SCHPO - dbPTM
SPT4_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID SPT4_SCHPO
UniProt AC Q9P7K8
Protein Name Transcription elongation factor spt4
Gene Name spt4
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 105
Subcellular Localization Nucleus. Chromosome, centromere. Centromere and heterochromatin..
Protein Description The spt4-spt5 complex mediates both activation and inhibition of transcription elongation, and plays a role in pre-mRNA processing. This complex seems to be important for the stability of the RNA polymerase II elongation machinery on the chromatin template but not for the inherent ability of this machinery to translocate down the gene (By similarity)..
Protein Sequence MDKLNRTRSRACLICGIVLPHSVFANKGCPNDGVDDVETFTSPVFEGIMAMMSPTESWVARWQRIDTFTPGIYATRVQGVLNEDVVESLRRRGINYRPRNGTSWD
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of SPT4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of SPT4_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of SPT4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of SPT4_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
SPT5_SCHPOspt5physical
11893740

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of SPT4_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP