SPT4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPT4_SCHPO
• UniProt AC: Q9P7K8
• Protein Name: Transcription elongation factor spt4
• Gene Name: spt4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 105
• Subcellular Localization: Nucleus. Chromosome, centromere. Centromere and heterochromatin..
• Protein Description: The spt4-spt5 complex mediates both activation and inhibition of transcription elongation, and plays a role in pre-mRNA processing. This complex seems to be important for the stability of the RNA polymerase II elongation machinery on the chromatin template but not for the inherent ability of this machinery to translocate down the gene (By similarity)..
• Protein Sequence: MDKLNRTRSRACLICGIVLPHSVFANKGCPNDGVDDVETFTSPVFEGIMAMMSPTESWVARWQRIDTFTPGIYATRVQGVLNEDVVESLRRRGINYRPRNGTSWD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SPT4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPT4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPT4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPT4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPT5_SCHPO	spt5	physical	11893740

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.