UniProt ID | SPRR3_HUMAN | |
---|---|---|
UniProt AC | Q9UBC9 | |
Protein Name | Small proline-rich protein 3 | |
Gene Name | SPRR3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 169 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Cross-linked envelope protein of keratinocytes.. | |
Protein Sequence | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSYQQKQT ------CCHHHCCCC | 37.44 | 20599699 | |
9 | Phosphorylation | SSYQQKQTFTPPPQL CHHHCCCCCCCCHHH | 36.19 | 29759185 | |
11 | Phosphorylation | YQQKQTFTPPPQLQQ HHCCCCCCCCHHHHH | 37.97 | 27966365 | |
106 | Phosphorylation | TKVPEPGYTKVPEPG CCCCCCCCCCCCCCC | 17.69 | - | |
114 | Phosphorylation | TKVPEPGSIKVPDQG CCCCCCCCEECCCCC | 29.92 | 21299198 | |
146 | Phosphorylation | TKVPVPGYTKLPEPC EECCCCCCCCCCCCC | 8.47 | - | |
147 | Phosphorylation | KVPVPGYTKLPEPCP ECCCCCCCCCCCCCC | 31.83 | - | |
158 | Phosphorylation | EPCPSTVTPGPAQQK CCCCCCCCCCHHHHH | 23.71 | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPRR3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPRR3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPRR3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JOS2_HUMAN | JOSD2 | physical | 26186194 | |
JOS2_HUMAN | JOSD2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Characterization of two isoforms of human SPRR3 from saliva ofpreterm human newborn and autoptic fetal oral mucosa, parotid andsubmandibular gland samples."; Manconi B., Cabras T., Pisano E., Nemolato S., Inzitari R.,Iavarone F., Fanali C., Sanna M.T., Tirone C., Vento G., Romagnoli C.,Faa G., Castagnola M., Messana I.; Biochem. Biophys. Res. Commun. 398:477-481(2010). Cited for: NUCLEOTIDE SEQUENCE [MRNA], MASS SPECTROMETRY, CLEAVAGE OF INITIATORMETHIONINE, ACETYLATION AT SER-2, AND VARIANTS DEL 98-CYS--PRO-104 ANDVAL-149. |