SPNXA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPNXA_HUMAN
• UniProt AC: Q9NS26
• Protein Name: Sperm protein associated with the nucleus on the X chromosome A {ECO:0000305}
• Gene Name: SPANXA1 {ECO:0000312|HGNC:HGNC:11218}
• Organism: Homo sapiens (Human).
• Sequence Length: 97
• Subcellular Localization: Cytoplasm . Nucleus . Associated with nuclear craters.
• Protein Sequence: MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Acetylation	-----MDKQSSAGGV -----CCCCCCCCCC	51.27	19815725
5	Phosphorylation	---MDKQSSAGGVKR ---CCCCCCCCCCCC	28.09	-
6	Phosphorylation	--MDKQSSAGGVKRS --CCCCCCCCCCCCC	28.56	-
13	Phosphorylation	SAGGVKRSVPCDSNE CCCCCCCCCCCCCCH	25.37	30622161
18	Phosphorylation	KRSVPCDSNEANEMM CCCCCCCCCHHHHCC	43.20	29507054
28	Phosphorylation	ANEMMPETPTGDSDP HHHCCCCCCCCCCCC	21.93	22617229
30	Phosphorylation	EMMPETPTGDSDPQP HCCCCCCCCCCCCCC	62.13	30622161
33	Phosphorylation	PETPTGDSDPQPAPK CCCCCCCCCCCCCCC	53.16	30622161
44	Phosphorylation	PAPKKMKTSESSTIL CCCCCCCCCCCCEEE	33.94	23186163
45	Phosphorylation	APKKMKTSESSTILV CCCCCCCCCCCEEEE	29.93	25693802
47	Phosphorylation	KKMKTSESSTILVVR CCCCCCCCCEEEEEE	32.33	29507054
48	Phosphorylation	KMKTSESSTILVVRY CCCCCCCCEEEEEEE	18.53	29507054
49	Phosphorylation	MKTSESSTILVVRYR CCCCCCCEEEEEEEC	27.84	25693802
62	Phosphorylation	YRRNFKRTSPEELLN ECCCCCCCCHHHHHH	49.58	27732954
63	Phosphorylation	RRNFKRTSPEELLND CCCCCCCCHHHHHHH	34.05	27732954

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPNXA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPNXA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPNXA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
T2FA_HUMAN	GTF2F1	physical	28514442
UBB_HUMAN	UBB	physical	28514442
BRCA2_HUMAN	BRCA2	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.