dbPTM

SPAT4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPAT4_HUMAN
UniProt AC	Q8NEY3
Protein Name	Spermatogenesis-associated protein 4
Gene Name	SPATA4
Organism	Homo sapiens (Human).
Sequence Length	305
Subcellular Localization
Protein Description
Protein Sequence	MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQGLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLARKKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVSRSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRNMDKKP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	TAAALDKSPSLSPQL HHHHHCCCCCCCHHH	21.27	25693802
23	Phosphorylation	AALDKSPSLSPQLAA HHHCCCCCCCHHHCC	48.87	25693802
25	Phosphorylation	LDKSPSLSPQLAAPI HCCCCCCCHHHCCCC	18.22	25693802
159	Phosphorylation	LTHREIKSIQDDFVN HHHHHHHHCCCCCCC	31.01	22617229
168	Phosphorylation	QDDFVNFTDYSYQMR CCCCCCCCCCCCHHC	28.91	22617229
171	Phosphorylation	FVNFTDYSYQMRLPL CCCCCCCCCHHCCCC	16.23	22617229
258	Ubiquitination	SGRRYNLKVKRGRVV CCCCEEEEEECCCEE	41.91	32015554
273	Phosphorylation	PVLPNIGSGGSSHRE EECCCCCCCCCCCCE	35.86	25693802
276	Phosphorylation	PNIGSGGSSHREIHV CCCCCCCCCCCEEEE	26.88	25693802
277	Phosphorylation	NIGSGGSSHREIHVK CCCCCCCCCCEEEEE	29.82	25693802

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPAT4_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPAT4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPAT4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPAT4_HUMAN

Related Literatures of Post-Translational Modification