UniProt ID | SOX14_HUMAN | |
---|---|---|
UniProt AC | O95416 | |
Protein Name | Transcription factor SOX-14 | |
Gene Name | SOX14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 240 | |
Subcellular Localization | Nucleus . | |
Protein Description | Acts as a negative regulator of transcription.. | |
Protein Sequence | MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MSKPSDHIKRPM ---CCCCCHHCCCCH | 45.62 | 27251275 | |
19 | Phosphorylation | MNAFMVWSRGQRRKM HHCHHHCCHHHHHHH | 18.34 | 30631047 | |
36 | Phosphorylation | ENPKMHNSEISKRLG HCCCCCHHHHHHHHC | 22.94 | - | |
40 | Acetylation | MHNSEISKRLGAEWK CCHHHHHHHHCHHHH | 58.25 | 18585087 | |
98 | Phosphorylation | RYVFPLPYLGDTDPL CEEECCCCCCCCCHH | 30.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SOX14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SOX14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOX14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAIF1_HUMAN | NAIF1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...