SNX3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNX3_SCHPO
• UniProt AC: O94291
• Protein Name: Sorting nexin-3
• Gene Name: snx3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 143
• Subcellular Localization: Cytoplasm. Golgi apparatus membrane ; Peripheral membrane protein ; Cytoplasmic side . Prevacuolar compartment membrane ; Peripheral membrane protein ; Cytoplasmic side .
• Protein Description: Required for retention of late Golgi membrane proteins. Component of the retrieval machinery that functions by direct interaction with the cytosolic tails of certain TGN membrane proteins during the sorting/budding process at the prevacuolar compartment. Binds phosphatidylinositol 3-phosphate (PtdIns(P3)) (By similarity)..
• Protein Sequence: MDKLSRPEIRQQTTQQMYDVPENILEIDVINPQTHGIGRNMFTTYEIVCRTNMPYFRLHNSSVRRRYSEFEKFHDMLERESGRVSIPPLPGKIFTQRFRDDVIEERRQGLENFLRLVAGHPLIQTHSRVLSSFLQSPEFKPTP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
68	Phosphorylation	SSVRRRYSEFEKFHD HHHHHHHHHHHHHHH	33.72	29996109
136	Phosphorylation	VLSSFLQSPEFKPTP HHHHHHCCCCCCCCC	28.66	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNX3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNX3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNX3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YOP1_SCHPO	yop1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.