SNURF_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNURF_HUMAN
• UniProt AC: Q9Y675
• Protein Name: SNRPN upstream reading frame protein
• Gene Name: SNURF
• Organism: Homo sapiens (Human).
• Sequence Length: 71
• Subcellular Localization: Nucleus .
• Protein Sequence: MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	DRLHLRRTTEQHVPE HHHHHHHCHHCCCCC	28.40	27251275
14	Phosphorylation	RLHLRRTTEQHVPEV HHHHHHCHHCCCCCE	31.66	27251275
26	Ubiquitination	PEVEVQVKRRRTASL CCEEEEEEECHHHHC	24.09	-
30	Phosphorylation	VQVKRRRTASLSNQE EEEEECHHHHCCCCC	20.84	30576142
32	Phosphorylation	VKRRRTASLSNQECQ EEECHHHHCCCCCCE	31.55	27499020
34	Phosphorylation	RRRTASLSNQECQLY ECHHHHCCCCCCEEC	33.69	26552605
41	Phosphorylation	SNQECQLYPRRSQQQ CCCCCEECCCCCCCC	2.94	26074081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNURF_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNURF_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNURF_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.