SNAPN_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNAPN_DROME
• UniProt AC: Q9VQF9
• Protein Name: SNAPIN protein homolog
• Gene Name: Snapin {ECO:0000312|FlyBase:FBgn0031455}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 134
• Subcellular Localization: Membrane ; Peripheral membrane protein ; Cytoplasmic side . Cytoplasm, cytosol .
• Protein Description: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis. [PubMed: 20015953 May participate in the coupling of lysosomes to microtubule plus-end-directed kinesin motor (By similarity]
• Protein Sequence: MDSDSTVTSLEENTENFCTNPTRDILAEGITNLFKPTIERLDERVASTIQLQAELRGQLDALAAQLRDIEKAQSQIPEFADKVKELLNVKHKVTVISNVLVTSQERLTGLHKLIEKEQRRRQALLDSALSTNIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SNAPN_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNAPN_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNAPN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNAPN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BL1S2_DROME	Blos2	physical	22036573
DTBP1_DROME	Dysb	physical	22036573
BL1S2_DROME	Blos2	physical	20015953
DTBP1_DROME	Dysb	physical	20015953

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.