UniProt ID | SMCO3_HUMAN | |
---|---|---|
UniProt AC | A2RU48 | |
Protein Name | Single-pass membrane and coiled-coil domain-containing protein 3 | |
Gene Name | SMCO3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 225 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAQSDFLYPEN ----CCCCCCCCCCC | 29507054 | ||
138 | Phosphorylation | VAVKLVGSNVTTGII HHHHHHCCCCHHHHH | 27732954 | ||
141 | Phosphorylation | KLVGSNVTTGIINKL HHHCCCCHHHHHHHH | 27732954 | ||
142 | Phosphorylation | LVGSNVTTGIINKLV HHCCCCHHHHHHHHH | 27732954 | ||
214 | Phosphorylation | EKYNHAITEVINTVK HHHHHHHHHHHHHHH | - | ||
219 | Phosphorylation | AITEVINTVKHQMK- HHHHHHHHHHHHCC- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMCO3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMCO3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMCO3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...