SLP1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SLP1_DROME
• UniProt AC: P32030
• Protein Name: Fork head domain transcription factor slp1
• Gene Name: slp1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 322
• Subcellular Localization: Nucleus.
• Protein Description: Transcription factor involved in segmentation. Required for the formation of the mandibular lobe. Different levels of slp activity seem to be required in different segments..
• Protein Sequence: MVKSEMEFKSNFSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPAPSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPPQLNAELFQRMQFFGKFPSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SLP1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SLP1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SLP1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SLP1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GROU_DROME	gro	physical	14605208
LARK_DROME	lark	physical	14605208
GROU_DROME	gro	physical	11311161

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.