UniProt ID | SLIK4_HUMAN | |
---|---|---|
UniProt AC | Q8IW52 | |
Protein Name | SLIT and NTRK-like protein 4 | |
Gene Name | SLITRK4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 837 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . Cell membrane . |
|
Protein Description | It is involved in synaptogenesis and promotes synapse differentiation. [PubMed: 27812321 Suppresses neurite outgrowth (By similarity] | |
Protein Sequence | MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDVFHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
81 | N-linked_Glycosylation | LYPNTFLNFSHAVSL ECCCCCCCHHHEEEE | 31.98 | UniProtKB CARBOHYD | |
301 | O-linked_Glycosylation | TSLHRLVTKPPKTTN CCEEHHCCCCCCCCC | 42.28 | 55833113 | |
306 | O-linked_Glycosylation | LVTKPPKTTNPSKIS HCCCCCCCCCHHHCC | 37.26 | 55833119 | |
307 | O-linked_Glycosylation | VTKPPKTTNPSKISG CCCCCCCCCHHHCCC | 51.78 | 55833125 | |
325 | N-linked_Glycosylation | GKALSNRNLSQIVSY CCCCCCCCHHHHCEE | 48.58 | UniProtKB CARBOHYD | |
334 | O-linked_Glycosylation | SQIVSYQTRVPPLTP HHHCEEECCCCCCCC | 25.96 | OGP | |
381 | Acetylation | PKPLNAKKLHVNGNS CCCCCCCEEEECCCC | 41.22 | 18528567 | |
663 | Phosphorylation | LGNPDCGSMQLQLRK CCCCCCHHHHHHHHH | 15.08 | 20873877 | |
718 | Ubiquitination | FSDPPGQKVVMRNVA CCCCCCCEEEEEECC | 42.59 | 23503661 | |
736 | Phosphorylation | KDLLHVDTRKRLSTI CCCCCCCHHHHCCCH | 36.68 | - | |
741 | Phosphorylation | VDTRKRLSTIDELDE CCHHHHCCCHHHHHH | 27.61 | 30266825 | |
742 | Phosphorylation | DTRKRLSTIDELDEL CHHHHCCCHHHHHHH | 36.72 | 30266825 | |
755 | Phosphorylation | ELFPSRDSNVFIQNF HHCCCCCCCHHHHHH | 33.51 | 22617229 | |
765 | Phosphorylation | FIQNFLESKKEYNSI HHHHHHHCCHHHCCC | 51.69 | 29449344 | |
766 | Ubiquitination | IQNFLESKKEYNSIG HHHHHHCCHHHCCCC | 40.00 | 23503661 | |
767 | Ubiquitination | QNFLESKKEYNSIGV HHHHHCCHHHCCCCC | 74.78 | 23503661 | |
769 | Phosphorylation | FLESKKEYNSIGVSG HHHCCHHHCCCCCCC | 24.08 | 25159151 | |
792 | Methylation | QPDKKSKKSLIGGNH CCCCCCCCCCCCCCC | 58.55 | 23644510 | |
801 | Methylation | LIGGNHSKIVVEQRK CCCCCCCCEEEEECC | 31.78 | 23644510 | |
809 | Phosphorylation | IVVEQRKSEYFELKA EEEEECCHHHHHHHH | 39.45 | 26356563 | |
811 | Phosphorylation | VEQRKSEYFELKAKL EEECCHHHHHHHHHH | 14.94 | 26356563 | |
824 | Phosphorylation | KLQSSPDYLQVLEEQ HHHCCHHHHHHHHHH | 11.47 | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SLIK4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLIK4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLIK4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNPY3_HUMAN | CNPY3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...