UniProt ID | SLBP_CAEEL | |
---|---|---|
UniProt AC | Q09599 | |
Protein Name | Histone RNA hairpin-binding protein | |
Gene Name | cdl-1 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 367 | |
Subcellular Localization | ||
Protein Description | Involved in histone pre-mRNA 3' processing. Required for chromosome condensation, progression of cell death and morphogenesis.. | |
Protein Sequence | MAQKTPTKGTRSSPRKKAWGSPIKATAKFQSDIFSVEDFADLSNRSWAEVTEEDDELASRLEEERRCKSESRRKGQPKRAQNSQNKPKFVRSLELTNEVFQSTSSRRSQRSKSRTRNGDTITTVEEHTETVVMESSSGPISRKRCLSNASTINEGASPSKRRPETGKSNRKAPRGRLFTNGGSDSSSVASSPSRRDHWEEPTLGWCTDEAVLKRRSREIDRAKEKAVYQRYTSEVPLRDRIKGQHPRTPNKLINFSRRSWDTQIKKWKRSLYEYCGEEPSDSVNTSFCYSDSDALSEAGDNDKEIENRSVLRDLVIPVTMRPEVDSMASLLGKFDVDSQMGMDESTLKASTNTDPSAPTDFSKMSSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | PRKKAWGSPIKATAK CCHHHCCCCCHHHHH | 16.86 | 28854356 | |
46 | Phosphorylation | FADLSNRSWAEVTEE HHHHCCCCHHCCCHH | 34.58 | 30078680 | |
157 | Phosphorylation | STINEGASPSKRRPE HHCCCCCCCCCCCCC | 40.33 | 19060867 | |
159 | Phosphorylation | INEGASPSKRRPETG CCCCCCCCCCCCCCC | 35.98 | 21082442 | |
190 | Phosphorylation | SDSSSVASSPSRRDH CCCCCCCCCCCCCCC | 40.40 | 30078680 | |
191 | Phosphorylation | DSSSVASSPSRRDHW CCCCCCCCCCCCCCC | 19.70 | 30078680 | |
248 | Phosphorylation | IKGQHPRTPNKLINF CCCCCCCCCCCHHCC | 35.35 | 19530675 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SLBP_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLBP_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLBP_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IMA3_CAEEL | ima-3 | physical | 18692475 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...