dbPTM

SLBP_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SLBP_CAEEL
UniProt AC	Q09599
Protein Name	Histone RNA hairpin-binding protein
Gene Name	cdl-1
Organism	Caenorhabditis elegans.
Sequence Length	367
Subcellular Localization
Protein Description	Involved in histone pre-mRNA 3' processing. Required for chromosome condensation, progression of cell death and morphogenesis..
Protein Sequence	MAQKTPTKGTRSSPRKKAWGSPIKATAKFQSDIFSVEDFADLSNRSWAEVTEEDDELASRLEEERRCKSESRRKGQPKRAQNSQNKPKFVRSLELTNEVFQSTSSRRSQRSKSRTRNGDTITTVEEHTETVVMESSSGPISRKRCLSNASTINEGASPSKRRPETGKSNRKAPRGRLFTNGGSDSSSVASSPSRRDHWEEPTLGWCTDEAVLKRRSREIDRAKEKAVYQRYTSEVPLRDRIKGQHPRTPNKLINFSRRSWDTQIKKWKRSLYEYCGEEPSDSVNTSFCYSDSDALSEAGDNDKEIENRSVLRDLVIPVTMRPEVDSMASLLGKFDVDSQMGMDESTLKASTNTDPSAPTDFSKMSSH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	PRKKAWGSPIKATAK CCHHHCCCCCHHHHH	16.86	28854356
46	Phosphorylation	FADLSNRSWAEVTEE HHHHCCCCHHCCCHH	34.58	30078680
157	Phosphorylation	STINEGASPSKRRPE HHCCCCCCCCCCCCC	40.33	19060867
159	Phosphorylation	INEGASPSKRRPETG CCCCCCCCCCCCCCC	35.98	21082442
190	Phosphorylation	SDSSSVASSPSRRDH CCCCCCCCCCCCCCC	40.40	30078680
191	Phosphorylation	DSSSVASSPSRRDHW CCCCCCCCCCCCCCC	19.70	30078680
248	Phosphorylation	IKGQHPRTPNKLINF CCCCCCCCCCCHHCC	35.35	19530675

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SLBP_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SLBP_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SLBP_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
IMA3_CAEEL	ima-3	physical	18692475

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SLBP_CAEEL

Related Literatures of Post-Translational Modification