IMA3_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IMA3_CAEEL
• UniProt AC: Q19969
• Protein Name: Importin subunit alpha-3
• Gene Name: ima-3
• Organism: Caenorhabditis elegans.
• Sequence Length: 514
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Promotes docking of import substrates to the nuclear envelope. Seems to act as a cytosolic receptor for both simple and bipartite NLS motifs. Necessary for correct nucleoporin localization within the germline.; Essential gene for embryonic and larval development. Required for oogenic development, ima-1 and ima-2 cannot functionally compensate for loss of ima-3..
• Protein Sequence: MSSNRQAYYKNNAKEQIGKEKRNEEVVSIRKDKREEAISKRRNINTQIEDDSETSTTPPGPFDANLLRLTVAAAQSSDPAEQLTAVQQARKMLSTDRNPPIDDLIGSGILPVLVQCLSSTDPNLQFEAAWALTNIASGTSEQTQAVVNAGAVPLFLQLLSCGNLNVCEQSVWALGNIIGDGPHFRDYCLELGILQPLLQFINPEIPIGFLRNVTWVIVNLCRCKDPAPSPAVVRTILPALSLLIHHQDTNILIDTVWALSYLTDGGNEHIQMVIEAQVVTHLVPLLGHVDVKVQTAALRAVGNIVTGTDEQTQLVLDSGVLRFMPGLLAHYKEKINKEAVWFVSNITAGNQQQVQDVFDAGIMPMIIHLLDRGDFPTQKEAAWAISNVTISGRPNQVEQMVKLGVLRPFCAMLSCTDSQIIQVVLDGINNILKMAGEAAEQVTSEIEECGGLDKIENLQNHENEDIYKLAFEIIDNFFSSDDETGNVEGAQSSAFGGDVPPVPDAPNGGWNFGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	Phosphorylation	SKRRNINTQIEDDSE HHHCCCCCCCCCCCC	27.42	30078680
52	Phosphorylation	NTQIEDDSETSTTPP CCCCCCCCCCCCCCC	55.91	30078680
54	Phosphorylation	QIEDDSETSTTPPGP CCCCCCCCCCCCCCC	35.01	30078680
55	Phosphorylation	IEDDSETSTTPPGPF CCCCCCCCCCCCCCC	26.65	30078680
56	Phosphorylation	EDDSETSTTPPGPFD CCCCCCCCCCCCCCC	51.22	28854356
57	Phosphorylation	DDSETSTTPPGPFDA CCCCCCCCCCCCCCH	27.53	28854356
444	Phosphorylation	EAAEQVTSEIEECGG HHHHHHHHHHHHHCC	37.41	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IMA3_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IMA3_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IMA3_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LMN1_CAEEL	lmn-1	physical	14704431
NHR20_CAEEL	nhr-20	physical	14704431
EI2BA_CAEEL	ZK1098.4	physical	14704431

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.