dbPTM

SIDA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SIDA_SCHPO
UniProt AC	Q9P7T0
Protein Name	L-ornithine N(5)-monooxygenase {ECO:0000303\|PubMed:15689108}
Gene Name	sib2 {ECO:0000312\|PomBase:SPAC23G3.03}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	431
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes the conversion of L-ornithine to N(5)-hydroxyornithine, the first step in the biosynthesis of all hydroxamate-containing siderophores, such as ferrichrome..
Protein Sequence	MTEPLDLAIIGFGPASLSFLIALHDHSEEPLKNKKIRVFEKLPTFSWHEGMLIPGSNMQISFVKDLATPRDPTSYFTFLNYLHSHGQERLSGFLNMSTLEPSRYEYHDYLCWAASHFSKFVEYNANINKLHYDAATDLYIVGHGDTQWQAKNIIITTGCQPYIPPLYKSVDSPLIVHSSKFMSDHSQKLLRNSKHGILVVGCGQSAAEIWKHCHYSLDPKTPLAMCFRNLAPVPSDSSPFVNSLYFDSHNSHWWYNLPTEARLKGLSVGRTTNYSVVKESLLEEMFKECYLQKLRYGQEFHQIMGDTDIQSIKNEGDHLVVQLTSQMDKSKKPETRKIDVLYVATGYDHESFDVLMSSLFPNSQGAQISEEYCVLNAPSKQGKVYVAGITSNQHGIGETLLSWAAIRAGGLAKELFGPSKPTARVPASYLN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SIDA_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SIDA_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SIDA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SIDA_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PUB3_SCHPO	pub3	physical	26771498
BYR2_SCHPO	byr2	physical	26771498
NIF3_SCHPO	SPCC126.12	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SIDA_SCHPO

Related Literatures of Post-Translational Modification