UniProt ID | SI11A_HUMAN | |
---|---|---|
UniProt AC | P58511 | |
Protein Name | Small integral membrane protein 11A {ECO:0000312|HGNC:HGNC:1293} | |
Gene Name | SMIM11A {ECO:0000312|HGNC:HGNC:1293} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 58 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Ubiquitination | QRKRLEAKQQKLEAE HHHHHHHHHHHHHHH | 33845483 | ||
44 | Ubiquitination | RLEAKQQKLEAERKK HHHHHHHHHHHHHHH | 24816145 | ||
56 | Ubiquitination | RKKQSEKKDN----- HHHHHHHCCC----- | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SI11A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SI11A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SI11A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...