SH3L2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SH3L2_HUMAN
• UniProt AC: Q9UJC5
• Protein Name: SH3 domain-binding glutamic acid-rich-like protein 2
• Gene Name: SH3BGRL2
• Organism: Homo sapiens (Human).
• Sequence Length: 107
• Subcellular Localization: Nucleus .
• Protein Sequence: MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	VIRVFIASSSGFVAI EEEEEEECCCCEEEE	21.88	21406692
10	Phosphorylation	IRVFIASSSGFVAIK EEEEEECCCCEEEEE	26.01	21406692
11	Phosphorylation	RVFIASSSGFVAIKK EEEEECCCCEEEEEE	33.48	21406692
90	Ubiquitination	FESKESNTVFSFLGL CCCCCCCCEEEECCC	32.01	21890473
98	Ubiquitination	VFSFLGLKPRLASKA EEEECCCCHHHHHCC	26.71	33845483
103	Phosphorylation	GLKPRLASKAEP--- CCCHHHHHCCCC---	36.67	29496963

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SH3L2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SH3L2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SH3L2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UB2D1_HUMAN	UBE2D1	physical	22939629

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.