UniProt ID | SH3L2_HUMAN | |
---|---|---|
UniProt AC | Q9UJC5 | |
Protein Name | SH3 domain-binding glutamic acid-rich-like protein 2 | |
Gene Name | SH3BGRL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 107 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | VIRVFIASSSGFVAI EEEEEEECCCCEEEE | 21.88 | 21406692 | |
10 | Phosphorylation | IRVFIASSSGFVAIK EEEEEECCCCEEEEE | 26.01 | 21406692 | |
11 | Phosphorylation | RVFIASSSGFVAIKK EEEEECCCCEEEEEE | 33.48 | 21406692 | |
90 | Ubiquitination | FESKESNTVFSFLGL CCCCCCCCEEEECCC | 32.01 | 21890473 | |
98 | Ubiquitination | VFSFLGLKPRLASKA EEEECCCCHHHHHCC | 26.71 | 33845483 | |
103 | Phosphorylation | GLKPRLASKAEP--- CCCHHHHHCCCC--- | 36.67 | 29496963 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SH3L2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SH3L2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SH3L2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UB2D1_HUMAN | UBE2D1 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...