UniProt ID | SGCZ_MOUSE | |
---|---|---|
UniProt AC | Q8BX51 | |
Protein Name | Zeta-sarcoglycan | |
Gene Name | Sgcz | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 311 | |
Subcellular Localization |
Cell membrane, sarcolemma Single-pass type II membrane protein. Cytoplasm, cytoskeleton. |
|
Protein Description | Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. May play a role in the maintenance of striated muscle membrane stability.. | |
Protein Sequence | MDRSTDLDIQELKMTREQYILATQQNNLPRPENAQLYPVGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGNLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTVGAEAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLKMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNADSIRLGNLPIGSFSSSTSSSNSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSSICLWN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MDRSTDLDIQE ----CCCCCCCCHHH | 23.24 | 29233185 | |
5 | Phosphorylation | ---MDRSTDLDIQEL ---CCCCCCCCHHHH | 41.28 | 29233185 | |
75 | N-linked_Glycosylation | IWILKVMNFTVDGMG HHHHHHHCCCCCCCC | 32.21 | - | |
123 | N-linked_Glycosylation | LVLQSDRNVTVNARN EEEECCCCEEEECCH | 38.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGCZ_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGCZ_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGCZ_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...