dbPTM

SGCZ_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SGCZ_MOUSE
UniProt AC	Q8BX51
Protein Name	Zeta-sarcoglycan
Gene Name	Sgcz
Organism	Mus musculus (Mouse).
Sequence Length	311
Subcellular Localization	Cell membrane, sarcolemma Single-pass type II membrane protein. Cytoplasm, cytoskeleton.
Protein Description	Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. May play a role in the maintenance of striated muscle membrane stability..
Protein Sequence	MDRSTDLDIQELKMTREQYILATQQNNLPRPENAQLYPVGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGNLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTVGAEAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLKMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNADSIRLGNLPIGSFSSSTSSSNSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSSICLWN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MDRSTDLDIQE ----CCCCCCCCHHH	23.24	29233185
5	Phosphorylation	---MDRSTDLDIQEL ---CCCCCCCCHHHH	41.28	29233185
75	N-linked_Glycosylation	IWILKVMNFTVDGMG HHHHHHHCCCCCCCC	32.21	-
123	N-linked_Glycosylation	LVLQSDRNVTVNARN EEEECCCCEEEECCH	38.51	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SGCZ_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SGCZ_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SGCZ_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
DMD_MOUSE	Dmd	physical	12189167

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SGCZ_MOUSE

Related Literatures of Post-Translational Modification