UniProt ID | SFTPD_MOUSE | |
---|---|---|
UniProt AC | P50404 | |
Protein Name | Pulmonary surfactant-associated protein D | |
Gene Name | Sftpd | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 374 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film. | |
Protein Description | Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.. | |
Protein Sequence | MLPFLSMLVLLVQPLGNLGAEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | S-nitrosocysteine | QRSVPNTCTLVMCSP HCCCCCEEEEEECCC | 3.35 | - | |
34 | S-nitrosylation | QRSVPNTCTLVMCSP HCCCCCEEEEEECCC | 3.35 | - | |
39 | S-nitrosocysteine | NTCTLVMCSPTENGL CEEEEEECCCCCCCC | 3.25 | - | |
39 | S-nitrosylation | NTCTLVMCSPTENGL CEEEEEECCCCCCCC | 3.25 | - | |
89 | N-linked_Glycosylation | PVGPKGENGSAGEPG CCCCCCCCCCCCCCC | 59.39 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFTPD_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
34 | C | S-nitrosylation |
| - |
39 | C | S-nitrosylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFTPD_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SFTPD_MOUSE | Sftpd | physical | 11278637 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...