UniProt ID | SFTPA_RAT | |
---|---|---|
UniProt AC | P08427 | |
Protein Name | Pulmonary surfactant-associated protein A | |
Gene Name | Sftpa1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 248 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film. | |
Protein Description | In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.. | |
Protein Sequence | MSLCSLAFTLFLTVVAGIKCNVTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Hydroxylation | TDVCAGSPGIPGAPG CHHCCCCCCCCCCCC | 43.76 | 3579914 | |
33 | Hydroxylation | CAGSPGIPGAPGNHG CCCCCCCCCCCCCCC | 38.52 | 3579914 | |
36 | Hydroxylation | SPGIPGAPGNHGLPG CCCCCCCCCCCCCCC | 50.46 | 3579914 | |
42 | Hydroxylation | APGNHGLPGRDGRDG CCCCCCCCCCCCCCC | 40.12 | 3579914 | |
54 | Hydroxylation | RDGVKGDPGPPGPMG CCCCCCCCCCCCCCC | 66.90 | 3579914 | |
57 | Hydroxylation | VKGDPGPPGPMGPPG CCCCCCCCCCCCCCC | 66.49 | 3579914 | |
63 | Hydroxylation | PPGPMGPPGGMPGLP CCCCCCCCCCCCCCC | 46.36 | 3579914 | |
67 | Hydroxylation | MGPPGGMPGLPGRDG CCCCCCCCCCCCCCC | 44.43 | 3579914 | |
70 | Hydroxylation | PGGMPGLPGRDGLPG CCCCCCCCCCCCCCC | 41.51 | 3579914 | |
76 | Hydroxylation | LPGRDGLPGAPGAPG CCCCCCCCCCCCCCC | 42.29 | 3579914 | |
207 | N-linked_Glycosylation | YLDGASVNYTNWYPG ECCCCCEECCCCCCC | 35.10 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFTPA_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFTPA_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFTPA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...