SFTPA_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SFTPA_RAT
• UniProt AC: P08427
• Protein Name: Pulmonary surfactant-associated protein A
• Gene Name: Sftpa1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 248
• Subcellular Localization: Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
• Protein Description: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages..
• Protein Sequence: MSLCSLAFTLFLTVVAGIKCNVTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Hydroxylation	TDVCAGSPGIPGAPG CHHCCCCCCCCCCCC	43.76	3579914
33	Hydroxylation	CAGSPGIPGAPGNHG CCCCCCCCCCCCCCC	38.52	3579914
36	Hydroxylation	SPGIPGAPGNHGLPG CCCCCCCCCCCCCCC	50.46	3579914
42	Hydroxylation	APGNHGLPGRDGRDG CCCCCCCCCCCCCCC	40.12	3579914
54	Hydroxylation	RDGVKGDPGPPGPMG CCCCCCCCCCCCCCC	66.90	3579914
57	Hydroxylation	VKGDPGPPGPMGPPG CCCCCCCCCCCCCCC	66.49	3579914
63	Hydroxylation	PPGPMGPPGGMPGLP CCCCCCCCCCCCCCC	46.36	3579914
67	Hydroxylation	MGPPGGMPGLPGRDG CCCCCCCCCCCCCCC	44.43	3579914
70	Hydroxylation	PGGMPGLPGRDGLPG CCCCCCCCCCCCCCC	41.51	3579914
76	Hydroxylation	LPGRDGLPGAPGAPG CCCCCCCCCCCCCCC	42.29	3579914
207	N-linked_Glycosylation	YLDGASVNYTNWYPG ECCCCCEECCCCCCC	35.10	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SFTPA_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SFTPA_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SFTPA_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRDX6_RAT	Prdx6	physical	16330552

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.