| UniProt ID | SFTPA_RAT | |
|---|---|---|
| UniProt AC | P08427 | |
| Protein Name | Pulmonary surfactant-associated protein A | |
| Gene Name | Sftpa1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 248 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film. | |
| Protein Description | In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.. | |
| Protein Sequence | MSLCSLAFTLFLTVVAGIKCNVTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Hydroxylation | TDVCAGSPGIPGAPG CHHCCCCCCCCCCCC | 43.76 | 3579914 | |
| 33 | Hydroxylation | CAGSPGIPGAPGNHG CCCCCCCCCCCCCCC | 38.52 | 3579914 | |
| 36 | Hydroxylation | SPGIPGAPGNHGLPG CCCCCCCCCCCCCCC | 50.46 | 3579914 | |
| 42 | Hydroxylation | APGNHGLPGRDGRDG CCCCCCCCCCCCCCC | 40.12 | 3579914 | |
| 54 | Hydroxylation | RDGVKGDPGPPGPMG CCCCCCCCCCCCCCC | 66.90 | 3579914 | |
| 57 | Hydroxylation | VKGDPGPPGPMGPPG CCCCCCCCCCCCCCC | 66.49 | 3579914 | |
| 63 | Hydroxylation | PPGPMGPPGGMPGLP CCCCCCCCCCCCCCC | 46.36 | 3579914 | |
| 67 | Hydroxylation | MGPPGGMPGLPGRDG CCCCCCCCCCCCCCC | 44.43 | 3579914 | |
| 70 | Hydroxylation | PGGMPGLPGRDGLPG CCCCCCCCCCCCCCC | 41.51 | 3579914 | |
| 76 | Hydroxylation | LPGRDGLPGAPGAPG CCCCCCCCCCCCCCC | 42.29 | 3579914 | |
| 207 | N-linked_Glycosylation | YLDGASVNYTNWYPG ECCCCCEECCCCCCC | 35.10 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFTPA_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFTPA_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFTPA_RAT !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...