dbPTM

SFC7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SFC7_SCHPO
UniProt AC	A6X980
Protein Name	Transcription factor tau subunit sfc7
Gene Name	sfc7 {ECO:0000312\|EMBL:CAO77650.1}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	120
Subcellular Localization	Nucleus .
Protein Description	TFIIIC mediates tRNA and 5S RNA gene activation by binding to intragenic promoter elements. Upstream of the transcription start site, TFIIIC assembles the initiation complex TFIIIB-TFIIIC-tDNA, which is sufficient for RNA polymerase III recruitment and function. Part of the tauA domain of TFIIIC that binds boxA DNA promoter sites of tRNA and similar genes (By similarity)..
Protein Sequence	MSSNSPSLETDVDDVENIVFQFQNSSLDFQSSDDFSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIVVPSVNDSELSRDGLVLCKRRLMLEQIRLVPKNPSPSSSIHSPTQGEPENISEN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
101	Phosphorylation	RLVPKNPSPSSSIHS EECCCCCCCCCCCCC	46.97	24763107
103	Phosphorylation	VPKNPSPSSSIHSPT CCCCCCCCCCCCCCC	40.84	25720772
108	Phosphorylation	SPSSSIHSPTQGEPE CCCCCCCCCCCCCCC	28.15	27738172
110	Phosphorylation	SSSIHSPTQGEPENI CCCCCCCCCCCCCCC	52.82	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SFC7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SFC7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SFC7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CUF1_SCHPO	cuf1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SFC7_SCHPO

Related Literatures of Post-Translational Modification