UniProt ID | SFC7_SCHPO | |
---|---|---|
UniProt AC | A6X980 | |
Protein Name | Transcription factor tau subunit sfc7 | |
Gene Name | sfc7 {ECO:0000312|EMBL:CAO77650.1} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 120 | |
Subcellular Localization | Nucleus . | |
Protein Description | TFIIIC mediates tRNA and 5S RNA gene activation by binding to intragenic promoter elements. Upstream of the transcription start site, TFIIIC assembles the initiation complex TFIIIB-TFIIIC-tDNA, which is sufficient for RNA polymerase III recruitment and function. Part of the tauA domain of TFIIIC that binds boxA DNA promoter sites of tRNA and similar genes (By similarity).. | |
Protein Sequence | MSSNSPSLETDVDDVENIVFQFQNSSLDFQSSDDFSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIVVPSVNDSELSRDGLVLCKRRLMLEQIRLVPKNPSPSSSIHSPTQGEPENISEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
101 | Phosphorylation | RLVPKNPSPSSSIHS EECCCCCCCCCCCCC | 46.97 | 24763107 | |
103 | Phosphorylation | VPKNPSPSSSIHSPT CCCCCCCCCCCCCCC | 40.84 | 25720772 | |
108 | Phosphorylation | SPSSSIHSPTQGEPE CCCCCCCCCCCCCCC | 28.15 | 27738172 | |
110 | Phosphorylation | SSSIHSPTQGEPENI CCCCCCCCCCCCCCC | 52.82 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFC7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFC7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFC7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CUF1_SCHPO | cuf1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...