UniProt ID | SERF1_HUMAN | |
---|---|---|
UniProt AC | O75920 | |
Protein Name | Small EDRK-rich factor 1 | |
Gene Name | SERF1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 110 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | O-linked_Glycosylation | RQKNMKKTQEISKGK HHHHHHHHHHHHHCC | 26.39 | 30379171 | |
22 | Phosphorylation | MKKTQEISKGKRKED HHHHHHHHHCCCHHH | 34.30 | 26657352 | |
27 | Ubiquitination | EISKGKRKEDSLTAS HHHHCCCHHHHCCHH | 70.16 | 29967540 | |
30 | Phosphorylation | KGKRKEDSLTASQRK HCCCHHHHCCHHHHH | 28.81 | 24719451 | |
32 | Phosphorylation | KRKEDSLTASQRKQS CCHHHHCCHHHHHHC | 28.37 | 25159151 | |
32 (in isoform 2) | Phosphorylation | - | 28.37 | 25627689 | |
34 | Phosphorylation | KEDSLTASQRKQSSG HHHHCCHHHHHHCCC | 25.86 | 21815630 | |
34 (in isoform 2) | Phosphorylation | - | 25.86 | 25159151 | |
36 | Methylation | DSLTASQRKQSSGGQ HHCCHHHHHHCCCCC | 36.16 | 24395477 | |
41 | Phosphorylation | SQRKQSSGGQKSESK HHHHHCCCCCCCCCC | 48.04 | 24719451 | |
41 (in isoform 2) | Phosphorylation | - | 48.04 | 24719451 | |
45 | Phosphorylation | QSSGGQKSESKMSAG HCCCCCCCCCCCCCC | 38.93 | - | |
47 | Phosphorylation | SGGQKSESKMSAGPH CCCCCCCCCCCCCCC | 40.52 | - | |
47 | O-linked_Glycosylation | SGGQKSESKMSAGPH CCCCCCCCCCCCCCC | 40.52 | 30379171 | |
47 | Ubiquitination | SGGQKSESKMSAGPH CCCCCCCCCCCCCCC | 40.52 | 33845483 | |
58 | Ubiquitination | AGPHLPLKAPRENPC CCCCCCCCCCCCCCC | 55.17 | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SERF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SERF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SERF1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...