| UniProt ID | SEP15_HUMAN | |
|---|---|---|
| UniProt AC | O60613 | |
| Protein Name | Selenoprotein F {ECO:0000303|PubMed:27645994} | |
| Gene Name | SELENOF {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:17705} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 165 | |
| Subcellular Localization | Endoplasmic reticulum lumen . The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum. | |
| Protein Description | May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum (By similarity).. | |
| Protein Sequence | MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MVAMAAGPSGCLV --CCCCCCCCCCCCH | 41.02 | 21406692 | |
| 80 | Ubiquitination | CCQEEAQFETKKLYA CCHHHHHHHHCHHHH | 33.32 | - | |
| 81 | Ubiquitination | CQEEAQFETKKLYAG CHHHHHHHHCHHHHH | 54.90 | - | |
| 83 | Ubiquitination | EEAQFETKKLYAGAI HHHHHHHCHHHHHHH | 16.33 | 21963094 | |
| 83 | 2-Hydroxyisobutyrylation | EEAQFETKKLYAGAI HHHHHHHCHHHHHHH | 16.33 | - | |
| 84 | Ubiquitination | EAQFETKKLYAGAIL HHHHHHCHHHHHHHH | 16.04 | 22817900 | |
| 119 | Ubiquitination | KPKLFRGLQIKYVRG CCCCCCCEEEEEEEC | 25.40 | - | |
| 120 | Phosphorylation | PKLFRGLQIKYVRGS CCCCCCEEEEEEECC | 9.30 | 28152594 | |
| 122 | Methylation | LFRGLQIKYVRGSDP CCCCEEEEEEECCCC | 35.49 | - | |
| 124 | Phosphorylation | RGLQIKYVRGSDPVL CCEEEEEEECCCCCH | 28.33 | 28152594 | |
| 142 | Phosphorylation | DDNGNIAEELSILKW CCCCCHHHHHHHHCC | 29.20 | 24719451 | |
| 148 | Phosphorylation | AEELSILKWNTDSVE HHHHHHHCCCCHHHH | 28.65 | 24719451 | |
| 150 | Phosphorylation | ELSILKWNTDSVEEF HHHHHCCCCHHHHHH | 29.41 | 28355574 | |
| 153 | Phosphorylation | ILKWNTDSVEEFLSE HHCCCCHHHHHHHHH | 50.13 | 27251275 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP15_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP15_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP15_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BAMBI_HUMAN | BAMBI | physical | 21900206 | |
| XRCC6_HUMAN | XRCC6 | physical | 21900206 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...