UniProt ID | SEP15_HUMAN | |
---|---|---|
UniProt AC | O60613 | |
Protein Name | Selenoprotein F {ECO:0000303|PubMed:27645994} | |
Gene Name | SELENOF {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:17705} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 165 | |
Subcellular Localization | Endoplasmic reticulum lumen . The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum. | |
Protein Description | May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum (By similarity).. | |
Protein Sequence | MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVAMAAGPSGCLV --CCCCCCCCCCCCH | 41.02 | 21406692 | |
80 | Ubiquitination | CCQEEAQFETKKLYA CCHHHHHHHHCHHHH | 33.32 | - | |
81 | Ubiquitination | CQEEAQFETKKLYAG CHHHHHHHHCHHHHH | 54.90 | - | |
83 | Ubiquitination | EEAQFETKKLYAGAI HHHHHHHCHHHHHHH | 16.33 | 21963094 | |
83 | 2-Hydroxyisobutyrylation | EEAQFETKKLYAGAI HHHHHHHCHHHHHHH | 16.33 | - | |
84 | Ubiquitination | EAQFETKKLYAGAIL HHHHHHCHHHHHHHH | 16.04 | 22817900 | |
119 | Ubiquitination | KPKLFRGLQIKYVRG CCCCCCCEEEEEEEC | 25.40 | - | |
120 | Phosphorylation | PKLFRGLQIKYVRGS CCCCCCEEEEEEECC | 9.30 | 28152594 | |
122 | Methylation | LFRGLQIKYVRGSDP CCCCEEEEEEECCCC | 35.49 | - | |
124 | Phosphorylation | RGLQIKYVRGSDPVL CCEEEEEEECCCCCH | 28.33 | 28152594 | |
142 | Phosphorylation | DDNGNIAEELSILKW CCCCCHHHHHHHHCC | 29.20 | 24719451 | |
148 | Phosphorylation | AEELSILKWNTDSVE HHHHHHHCCCCHHHH | 28.65 | 24719451 | |
150 | Phosphorylation | ELSILKWNTDSVEEF HHHHHCCCCHHHHHH | 29.41 | 28355574 | |
153 | Phosphorylation | ILKWNTDSVEEFLSE HHCCCCHHHHHHHHH | 50.13 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP15_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAMBI_HUMAN | BAMBI | physical | 21900206 | |
XRCC6_HUMAN | XRCC6 | physical | 21900206 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...