UniProt ID | BAMBI_HUMAN | |
---|---|---|
UniProt AC | Q13145 | |
Protein Name | BMP and activin membrane-bound inhibitor homolog | |
Gene Name | BAMBI | |
Organism | Homo sapiens (Human). | |
Sequence Length | 260 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | Negatively regulates TGF-beta signaling.. | |
Protein Sequence | MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MDRHSSYIFIWL ---CCCCHHHHHHHH | 26.23 | 24043423 | |
6 | Phosphorylation | --MDRHSSYIFIWLQ --CCCCHHHHHHHHH | 19.00 | 24043423 | |
7 | Phosphorylation | -MDRHSSYIFIWLQL -CCCCHHHHHHHHHH | 11.67 | 24043423 | |
24 | Phosphorylation | CAMAVLLTKGEIRCY HHHHHHHHCCCHHHE | 32.61 | 24043423 | |
31 | Phosphorylation | TKGEIRCYCDAAHCV HCCCHHHEECHHHHH | 5.41 | - | |
40 | Phosphorylation | DAAHCVATGYMCKSE CHHHHHHHHCCCHHH | 14.40 | - | |
83 | Ubiquitination | TTDICQAKQARNHSG CHHHHHHHHHHCCCC | 20.72 | 21963094 | |
87 | N-linked_Glycosylation | CQAKQARNHSGTTIP HHHHHHHCCCCCCCC | 36.37 | UniProtKB CARBOHYD | |
91 | O-linked_Glycosylation | QARNHSGTTIPTLEC HHHCCCCCCCCCHHH | 25.27 | OGP | |
114 | Phosphorylation | RGLHDVLSPPRGEAS CCCCCCCCCCCCCCC | 32.48 | 24719451 | |
114 | O-linked_Glycosylation | RGLHDVLSPPRGEAS CCCCCCCCCCCCCCC | 32.48 | 55832609 | |
132 | Phosphorylation | NRYQHDGSRNLITKV CCCCCCCCCCHHHHH | 24.85 | 22468782 | |
143 | Phosphorylation | ITKVQELTSSKELWF HHHHHHHHCCHHHHH | 30.15 | 22468782 | |
145 | Phosphorylation | KVQELTSSKELWFRA HHHHHHCCHHHHHHH | 25.55 | 22468782 | |
146 | Ubiquitination | VQELTSSKELWFRAA HHHHHCCHHHHHHHH | 57.50 | - | |
196 | Phosphorylation | QMLSRLHYSFHGHHS HHHHHHHHHHCCCCC | 20.02 | - | |
210 | Ubiquitination | SKKGQVAKLDLECMV CCCCCEEEEEEEEEC | 43.61 | 33845483 | |
231 | Sumoylation | NCCLTCDKMRQADLS CCEECCHHHHHHCCC | 37.82 | - | |
231 | Ubiquitination | NCCLTCDKMRQADLS CCEECCHHHHHHCCC | 37.82 | 33845483 | |
238 | Phosphorylation | KMRQADLSNDKILSL HHHHHCCCCCHHHHH | 43.46 | 29514088 | |
241 | Sumoylation | QADLSNDKILSLVHW HHCCCCCHHHHHHHH | 50.20 | - | |
241 | Ubiquitination | QADLSNDKILSLVHW HHCCCCCHHHHHHHH | 50.20 | 21890473 | |
251 | Phosphorylation | SLVHWGMYSGHGKLE HHHHHHHCCCCCCEE | 13.94 | 25884760 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BAMBI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAMBI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAMBI_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMAD7_HUMAN | SMAD7 | physical | 19758997 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...