SEM12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SEM12_ARATH
• UniProt AC: Q9FL96
• Protein Name: Protein DSS1 HOMOLOG ON CHROMOSOME V {ECO:0000303|PubMed:16415210}
• Gene Name: DSS1(V) {ECO:0000303|PubMed:16415210}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 73
• Protein Description: Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis (By similarity). Associates also with the TREX-2 complex that is required for transcription-coupled mRNA export. [PubMed: 19843313]
• Protein Sequence: MAAEPKAAVEVVKVDLFEDDDEFEEFEINEDWLEKEEVKEVSLQWEDDWDDDDVSDDFSRQLKKELENASEKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
42	Phosphorylation	KEEVKEVSLQWEDDW HHHHEEEEEECCCCC	18.88	23776212
55	Phosphorylation	DWDDDDVSDDFSRQL CCCCCCCCHHHHHHH	38.16	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SEM12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SEM12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SEM12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CML19_ARATH	CEN2	physical	19843313
PSD3B_ARATH	AT1G75990	physical	19843313
PSD3A_ARATH	EMB2719	physical	19843313

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.