CML19_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CML19_ARATH
• UniProt AC: O23184
• Protein Name: Calcium-binding protein CML19 {ECO:0000303|Ref.7}
• Gene Name: CML19 {ECO:0000303|Ref.7}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 167
• Subcellular Localization: Cytoplasm . Nucleus . Localizes to the nucleus after exposure to UV-C and cicplatin.
• Protein Description: Potential calcium sensor that binds calcium in vitro. [PubMed: 14688294 Modulates homologous recombination and nucleotide excision repair (NER)]
• Protein Sequence: MSEAAQLRRGLKPKGKTYGLTNQKRREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEFVHMMTTKFGERDSIDELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRDKDGEVNLEEFMKMMKRTSYG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
117	Phosphorylation	HDNNGKISPRDIKMI CCCCCCCCHHHHHHH	19.85	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CML19_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CML19_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CML19_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TON1B_ARATH	TON1B	physical	18757558
TON1A_ARATH	TON1A	physical	18757558

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.