SEC62_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SEC62_SCHPO
• UniProt AC: O13787
• Protein Name: Translocation protein sec62
• Gene Name: sec62
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 273
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and bip1 in a channel-forming translocon complex. In an initial step, the signal sequence seems to bind simultaneously to sec61 and sec62. sec62 and sec63 are required for interactions between sec61 and translocating polypeptides. sec62 may affect sec61-polypeptide interactions by increasing the affinity of targeting pathways for sec61 and/or by modifying sec61 to allow more efficient polypeptide interaction. A cycle of assembly and disassembly of Sec62/63 complex from sec61 may govern the activity of the translocon (By similarity)..
• Protein Sequence: MDSSNVPVLKDEDKCKFSMRFTNFLKSRPELKTKPAILNGKRVYYFRVKRVLRFLTSEAYTPKKYKGFPEISSREEAIEVLKLLIMNSMLVRVDKLPPKQRKQKLVELQINRNQDFQDDMHYVWLYEPLPKRVMALAVLFALVVLALVLFPLWPMFMRKGAWYLSMGGLGVIGLFFVLVILRFFLFCITAVIVRPGIWLFPNLLADVGFCDSFKPLWSWHNSKSEVKKTRKSKKLSKKATSPAASATPEKSSTSTTSLKNLRHRNPTVEEVSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
240	Phosphorylation	KKLSKKATSPAASAT HHHHHHCCCCCCCCC	44.09	25720772
241	Phosphorylation	KLSKKATSPAASATP HHHHHCCCCCCCCCC	19.87	24763107
245	Phosphorylation	KATSPAASATPEKSS HCCCCCCCCCCCCCC	34.48	29996109
247	Phosphorylation	TSPAASATPEKSSTS CCCCCCCCCCCCCCC	29.50	25720772
251	Phosphorylation	ASATPEKSSTSTTSL CCCCCCCCCCCCCCH	36.87	29996109
253	Phosphorylation	ATPEKSSTSTTSLKN CCCCCCCCCCCCHHH	36.86	25720772
254	Phosphorylation	TPEKSSTSTTSLKNL CCCCCCCCCCCHHHH	31.47	29996109
255	Phosphorylation	PEKSSTSTTSLKNLR CCCCCCCCCCHHHHH	22.09	29996109
256	Phosphorylation	EKSSTSTTSLKNLRH CCCCCCCCCHHHHHH	31.65	29996109
257	Phosphorylation	KSSTSTTSLKNLRHR CCCCCCCCHHHHHHC	37.12	29996109
267	Phosphorylation	NLRHRNPTVEEVSE- HHHHCCCCHHHHCC-	44.06	21712547
272	Phosphorylation	NPTVEEVSE------ CCCHHHHCC------	40.65	19547744

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SEC62_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SEC62_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SEC62_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SAD1_SCHPO	sad1	physical	23695164
SWS1_SCHPO	sws1	physical	26771498
SAD1_SCHPO	sad1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.