UniProt ID | SEC13_SCHPO | |
---|---|---|
UniProt AC | O94319 | |
Protein Name | Protein transport protein sec13 | |
Gene Name | sec13 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 297 | |
Subcellular Localization |
Cytoplasmic vesicle, COPII-coated vesicle membrane Peripheral membrane protein Cytoplasmic side. Endoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side. Nucleus, nuclear pore complex. |
|
Protein Description | Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. SEC13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution (By similarity). Involved in septum formation.. | |
Protein Sequence | MTTVDTQHDDMIHDAILDYYGKRLATCSSDQTIKVFSIENNQQTLLETLRGHSGPVWQLGWAHPKFGTILASASYDGHVIVWRETGGVWSELMDHTAHQASVNAVSWAPHEYGALLACASSDGKVSVLEFKDDGSCDTRIFTAHEPGCNAVCWSPPSLSGSVVGQSPAAGPKKLATAGCDNLVKIWAFDAGVNNWILEDTLAGHVDWTRDVAWAPSVGLTKTYLASASQDKNVFIWTKEGDGPWQKTPLTEEKFPDIAWRVSWSLSGNILAVSCGDNKVYLFKESQNKWQLLNELSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | KRLATCSSDQTIKVF CCEEECCCCCEEEEE | 35.57 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEC13_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEC13_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEC13_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC31_SCHPO | sec31 | physical | 23695164 | |
SEC31_SCHPO | sec31 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...