SDCB1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SDCB1_RAT
• UniProt AC: Q9JI92
• Protein Name: Syntenin-1
• Gene Name: Sdcbp
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 300
• Subcellular Localization: Cell junction, focal adhesion . Cell junction, adherens junction . Cell membrane ; Peripheral membrane protein . Endoplasmic reticulum membrane ; Peripheral membrane protein . Nucleus . Melanosome . Cytoplasm, cytosol . Cytoplasm, cytoskeleton . Secreted,
• Protein Description: Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis. Positively regulates TGFB1-mediated SMAD2/3 activation and TGFB1-induced epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types. May increase TGFB1 signaling by enhancing cell-surface expression of TGFR1 by preventing the interaction between TGFR1 and CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1. In concert with SDC1/4 and PDCD6IP, regulates exosome biogenesis. Regulates migration, growth, proliferation, and cell cycle progression in a variety of cancer types. In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). May also play a role in vesicular trafficking. Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway..
• Protein Sequence: MSLYPSLEDLKVDKVIQAQTASSANPASQAFFLNVVDSAAFPPGGNLYPKLYPELSQYMGLSLSEAEICENMPVVSGAPTQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSLYPSLED ------CCCCCCHHH	36.29	-
2	Phosphorylation	------MSLYPSLED ------CCCCCCHHH	36.29	22673903
4	Phosphorylation	----MSLYPSLEDLK ----CCCCCCHHHCC	5.40	22673903
6	Phosphorylation	--MSLYPSLEDLKVD --CCCCCCHHHCCCC	30.73	27097102
11	Acetylation	YPSLEDLKVDKVIQA CCCHHHCCCCCEEEC	61.79	22902405
48	Phosphorylation	FPPGGNLYPKLYPEL CCCCCCCCHHHHHHH	11.43	-
89	Phosphorylation	GQLVARPSSVNYMVA CCEEECCCCCCEEEE	41.17	27097102
90	Phosphorylation	QLVARPSSVNYMVAP CEEECCCCCCEEEEC	19.64	27097102
93	Phosphorylation	ARPSSVNYMVAPVTG ECCCCCCEEEECCCC	7.27	27097102
133	Phosphorylation	KIGLRLKSVDNGIFV CEEEEEEEECCCEEE	39.02	23984901

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SDCB1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SDCB1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SDCB1_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDCB1_RAT	Sdcbp	physical	11152476

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.