dbPTM

SC61B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SC61B_MOUSE
UniProt AC	Q9CQS8
Protein Name	Protein transport protein Sec61 subunit beta
Gene Name	Sec61b
Organism	Mus musculus (Mouse).
Sequence Length	96
Subcellular Localization	Endoplasmic reticulum membrane Single-pass membrane protein.
Protein Description	Necessary for protein translocation in the endoplasmic reticulum..
Protein Sequence	MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MPGPTPSGT ------CCCCCCCCC	58.43	-
5	Phosphorylation	---MPGPTPSGTNVG ---CCCCCCCCCCCC	35.68	23684622
7	Phosphorylation	-MPGPTPSGTNVGSS -CCCCCCCCCCCCCC	61.81	27742792
9	Phosphorylation	PGPTPSGTNVGSSGR CCCCCCCCCCCCCCC	30.94	27742792
13	Phosphorylation	PSGTNVGSSGRSPSK CCCCCCCCCCCCHHH	25.90	26824392
14	Phosphorylation	SGTNVGSSGRSPSKA CCCCCCCCCCCHHHH	32.09	27742792
17	Phosphorylation	NVGSSGRSPSKAVAA CCCCCCCCHHHHHHH	36.73	27087446
19	Phosphorylation	GSSGRSPSKAVAARA CCCCCCHHHHHHHHH	34.20	27087446
20	Succinylation	SSGRSPSKAVAARAA CCCCCHHHHHHHHHC	50.71	23806337
20	Malonylation	SSGRSPSKAVAARAA CCCCCHHHHHHHHHC	50.71	26320211
20	Acetylation	SSGRSPSKAVAARAA CCCCCHHHHHHHHHC	50.71	23806337
29	Phosphorylation	VAARAAGSTVRQRKN HHHHHCCCCHHHHCC	21.00	23140645
30	Phosphorylation	AARAAGSTVRQRKNA HHHHCCCCHHHHCCC	20.84	23140645
38	Phosphorylation	VRQRKNASCGTRSAG HHHHCCCCCCCCCCC	23.60	23140645
39	S-palmitoylation	RQRKNASCGTRSAGR HHHCCCCCCCCCCCC	6.32	-
47	Phosphorylation	GTRSAGRTTSAGTGG CCCCCCCCCCCCCCC	24.96	22324799
48	Phosphorylation	TRSAGRTTSAGTGGM CCCCCCCCCCCCCCC	18.41	25159016
49	Phosphorylation	RSAGRTTSAGTGGMW CCCCCCCCCCCCCCE	24.88	22942356
52	Phosphorylation	GRTTSAGTGGMWRFY CCCCCCCCCCCEEEE	30.22	25159016
60	Phosphorylation	GGMWRFYTEDSPGLK CCCEEEEECCCCCCC	30.51	28066266
63	Phosphorylation	WRFYTEDSPGLKVGP EEEEECCCCCCCCCC	18.03	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SC61B_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SC61B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SC61B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ASGR2_HUMAN	ASGR2	physical	11408579

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SC61B_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry."; Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.; Mol. Cell. Proteomics 8:904-912(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17, AND MASSSPECTROMETRY.	19131326 [Abstract]
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17, AND MASSSPECTROMETRY.	19367708 [Abstract]
"Specific phosphopeptide enrichment with immobilized titanium ionaffinity chromatography adsorbent for phosphoproteome analysis."; Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.; J. Proteome Res. 7:3957-3967(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17, AND MASSSPECTROMETRY.	18630941 [Abstract]
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17, AND MASSSPECTROMETRY.	17242355 [Abstract]