dbPTM

SC13A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SC13A_ARATH
UniProt AC	Q9SRI1
Protein Name	Protein transport protein SEC13 homolog A {ECO:0000305}
Gene Name	SEC13A {ECO:0000303\|PubMed:24280388}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	302
Subcellular Localization	Golgi apparatus . Endoplasmic reticulum .
Protein Description	Required for protein transport from the endoplasmic reticulum to the Golgi apparatus..
Protein Sequence	MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQVTVVEP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SC13A_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SC13A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SC13A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SC13A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SC13B_ARATH	AT2G30050	physical	21897010
SC13A_ARATH	AT3G01340	physical	21897010

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SC13A_ARATH

Related Literatures of Post-Translational Modification