UniProt ID | SC13A_ARATH | |
---|---|---|
UniProt AC | Q9SRI1 | |
Protein Name | Protein transport protein SEC13 homolog A {ECO:0000305} | |
Gene Name | SEC13A {ECO:0000303|PubMed:24280388} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 302 | |
Subcellular Localization | Golgi apparatus . Endoplasmic reticulum . | |
Protein Description | Required for protein transport from the endoplasmic reticulum to the Golgi apparatus.. | |
Protein Sequence | MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQVTVVEP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SC13A_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC13A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC13A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC13A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SC13B_ARATH | AT2G30050 | physical | 21897010 | |
SC13A_ARATH | AT3G01340 | physical | 21897010 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...