UniProt ID | SC11A_HUMAN | |
---|---|---|
UniProt AC | P67812 | |
Protein Name | Signal peptidase complex catalytic subunit SEC11A | |
Gene Name | SEC11A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 179 | |
Subcellular Localization |
Microsome membrane Single-pass type II membrane protein. Endoplasmic reticulum membrane Single-pass type II membrane protein. |
|
Protein Description | Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.. | |
Protein Sequence | MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Sulfoxidation | -------MLSLDFLD -------CCCCHHHH | 5.31 | 21406390 | |
3 | Phosphorylation | -----MLSLDFLDDV -----CCCCHHHHHH | 25.29 | 20068231 | |
4 (in isoform 2) | Phosphorylation | - | 4.80 | 25159151 | |
5 (in isoform 2) | Phosphorylation | - | 38.39 | 25159151 | |
19 | Phosphorylation | RMNKRQLYYQVLNFG HHCHHHHHHHHHHHH | 5.41 | 25262027 | |
20 | Phosphorylation | MNKRQLYYQVLNFGM HCHHHHHHHHHHHHH | 10.75 | 25262027 | |
30 | Phosphorylation | LNFGMIVSSALMIWK HHHHHHHHHHHHHHC | 10.04 | 25627689 | |
31 | Phosphorylation | NFGMIVSSALMIWKG HHHHHHHHHHHHHCC | 17.96 | 25627689 | |
43 | Phosphorylation | WKGLMVITGSESPIV HCCEEEECCCCCCEE | 24.20 | 20068231 | |
45 | Phosphorylation | GLMVITGSESPIVVV CEEEECCCCCCEEEE | 26.67 | 20068231 | |
47 | Phosphorylation | MVITGSESPIVVVLS EEECCCCCCEEEEEE | 22.94 | 26074081 | |
54 | Phosphorylation | SPIVVVLSGSMEPAF CCEEEEEECCCCCCC | 19.74 | 26074081 | |
56 | Phosphorylation | IVVVLSGSMEPAFHR EEEEEECCCCCCCCC | 19.32 | 20068231 | |
70 | Phosphorylation | RGDLLFLTNRVEDPI CCCEEEEECCCCCCC | 17.40 | 26074081 | |
74 | Ubiquitination | LFLTNRVEDPIRVGE EEEECCCCCCCCCCE | 55.63 | - | |
78 | Ubiquitination | NRVEDPIRVGEIVVF CCCCCCCCCCEEEEE | 35.46 | 21890473 | |
84 | Ubiquitination | IRVGEIVVFRIEGRE CCCCEEEEEEECCEE | 3.07 | - | |
88 | Ubiquitination | EIVVFRIEGREIPIV EEEEEEECCEECEEE | 48.19 | 21890473 | |
100 | Ubiquitination | PIVHRVLKIHEKQNG EEEEEEEEHHHHHCC | 38.88 | - | |
101 | Ubiquitination | IVHRVLKIHEKQNGH EEEEEEEHHHHHCCE | 4.42 | 21890473 | |
104 | Ubiquitination | RVLKIHEKQNGHIKF EEEEHHHHHCCEEEE | 34.60 | 21906983 | |
109 | Ubiquitination | HEKQNGHIKFLTKGD HHHHCCEEEEEECCC | 3.41 | 21890473 | |
110 | Ubiquitination | EKQNGHIKFLTKGDN HHHCCEEEEEECCCC | 28.75 | - | |
110 | Ubiquitination | EKQNGHIKFLTKGDN HHHCCEEEEEECCCC | 28.75 | - | |
114 | Ubiquitination | GHIKFLTKGDNNAVD CEEEEEECCCCCCCC | 67.43 | 21906983 | |
114 | Ubiquitination | GHIKFLTKGDNNAVD CEEEEEECCCCCCCC | 67.43 | 21890473 | |
127 | Ubiquitination | VDDRGLYKQGQHWLE CCCCCHHHCCCHHHH | 53.66 | 21906983 | |
127 | Ubiquitination | VDDRGLYKQGQHWLE CCCCCHHHCCCHHHH | 53.66 | 21890473 | |
135 | Ubiquitination | QGQHWLEKKDVVGRA CCCHHHHHCCCCHHH | 52.70 | - | |
135 | Ubiquitination | QGQHWLEKKDVVGRA CCCHHHHHCCCCHHH | 52.70 | 21890473 | |
136 | Ubiquitination | GQHWLEKKDVVGRAR CCHHHHHCCCCHHHC | 46.51 | - | |
146 (in isoform 4) | Phosphorylation | - | 3.81 | 27732954 | |
148 | Phosphorylation | RARGFVPYIGIVTIL HHCCCCCEEEEEEHH | 13.38 | 25348772 | |
150 (in isoform 4) | Phosphorylation | - | 11.50 | 27732954 | |
151 (in isoform 4) | Phosphorylation | - | 1.47 | 27732954 | |
153 | Phosphorylation | VPYIGIVTILMNDYP CCEEEEEEHHCCCCH | 13.38 | 25348772 | |
159 | Phosphorylation | VTILMNDYPKFKYAV EEHHCCCCHHHHHHH | 11.88 | 25348772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC11A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC11A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC11A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S35F6_HUMAN | SLC35F6 | physical | 16169070 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...