SBDS_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SBDS_MOUSE
• UniProt AC: P70122
• Protein Name: Ribosome maturation protein SBDS
• Gene Name: Sbds
• Organism: Mus musculus (Mouse).
• Sequence Length: 250
• Subcellular Localization: Cytoplasm. Nucleus, nucleolus. Nucleus, nucleoplasm. Cytoplasm, cytoskeleton, spindle. Detected in the cytoplasm, but not in the nucleus (PubMed:21536732). Primarily detected in the cytoplasm, and at low levels in nucleus (PubMed:19602484). Detected
• Protein Description: Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFL1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation (By similarity)..
• Protein Sequence: MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSIFTPTNQ ------CCCCCCCCC	26.81	-
2	Phosphorylation	------MSIFTPTNQ ------CCCCCCCCC	26.81	29176673
5	Phosphorylation	---MSIFTPTNQIRL ---CCCCCCCCCEEE	27.77	26824392
62	Ubiquitination	SVFVNVSKGQVAKKE EEEEECCCCCEECHH	49.43	22790023
73	Phosphorylation	AKKEDLISAFGTDDQ ECHHHHHHHHCCCCH	25.50	28973931
77	Phosphorylation	DLISAFGTDDQTEIC HHHHHHCCCCHHHHH	29.92	28973931
90	Ubiquitination	ICKQILTKGEVQVSD HHHHHHHCCCCCCCC	50.02	22790023
96	Phosphorylation	TKGEVQVSDKERHTQ HCCCCCCCCHHHHHH	26.35	30635358
98	Ubiquitination	GEVQVSDKERHTQLE CCCCCCCHHHHHHHH	49.49	22790023
118	Acetylation	IATIVADKCVNPETK HHHHHHHCCCCCCCC	30.28	22826441
118	Ubiquitination	IATIVADKCVNPETK HHHHHHHCCCCCCCC	30.28	22790023
119	Ubiquitination	ATIVADKCVNPETKR HHHHHHCCCCCCCCC	3.53	27667366
142	Phosphorylation	RAMKDIHYSVKPNKS CCCCCCCCCCCCCCC	18.59	29514104
143	Phosphorylation	AMKDIHYSVKPNKST CCCCCCCCCCCCCCH	14.98	-
151	Ubiquitination	VKPNKSTKQQALEVI CCCCCCHHHHHHHHH	47.72	-
151	Malonylation	VKPNKSTKQQALEVI CCCCCCHHHHHHHHH	47.72	26320211
159	Ubiquitination	QQALEVIKQLKEKMK HHHHHHHHHHHHHHC	55.54	22790023
184	Malonylation	ILPVNEGKKLKEKLK EEECCCCHHHHHHHH	49.07	26320211
225	Ubiquitination	REIDELIKKETKGRG HHHHHHHHHHHCCCC	58.12	27667366
233	Phosphorylation	KETKGRGSLEVLSLK HHHCCCCCEEEEEEE	21.72	29472430
238	Phosphorylation	RGSLEVLSLKDVEEG CCCEEEEEEECHHCC	38.25	27180971

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SBDS_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SBDS_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SBDS_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EFNA1_MOUSE	Efna1	physical	21536732

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.